Report for 5876.m00144

 > 5876.m00144, length: 405, copies: 1 

MTPAPAAASYRALVALLLVAVAVADDGSTLLEIKKSFRNVDNVLYDWAGGDYCSWRGVLCDNVTFAVAALNLSGL

NLGGEISPAVGRLKGIVSMYGRRGGVLCCCLEMWLAGAWTRSNFDLKSNGLSGQIPDEIGDCSSLKTLILKNNQL

IGVIPSTLSQLPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLEGSISPDICQLTGLWYLDLSYNKLSGS

IPFNIGFLQVATLSLQGNMFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYMQGNKLTGPIPPE

LGNMSTLHYLELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSFNAYGNRLNGTIPPSLHK

LESMTYLNLSSNFLSGSIPIELSRINNLDT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	139	162	0.18
LRR [Pfam ls]	163	185	2.3
LRR [Pfam ls]	187	210	0.18
LRR [Pfam ls]	211	231	6.4
LRR [Pfam ls]	234	257	6.6
LRR [Pfam ls]	258	281	0.0099
LRR [Pfam ls]	282	305	6
LRR [Pfam ls]	306	329	0.006
LRR [Pfam ls]	354	377	1.7
LRR [Pfam ls]	378	401	2.1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	66	89	1.9
LRR [sensitive, ls]	66	89	44
LRR [sensitive, ls]	139	162	0.0075
LRR [sensitive, ls]	139	162	0.18
LRR [sensitive, ls]	163	185	0.1
LRR [sensitive, ls]	163	185	2.3
LRR [sensitive, ls]	187	210	0.0076
LRR [sensitive, ls]	187	210	0.18
LRR [sensitive, ls]	211	231	0.28
LRR [sensitive, ls]	211	231	6.4
LRR [sensitive, ls]	234	257	0.28
LRR [sensitive, ls]	234	257	6.6
LRR [sensitive, ls]	258	281	0.00043
LRR [sensitive, ls]	258	281	0.0099
LRR [sensitive, ls]	282	305	0.26
LRR [sensitive, ls]	282	305	6
LRR [sensitive, ls]	306	329	0.00026
LRR [sensitive, ls]	306	329	0.006
LRR [sensitive, ls]	330	353	0.32
LRR [sensitive, ls]	330	353	7.5
LRR [sensitive, ls]	354	377	0.075
LRR [sensitive, ls]	354	377	1.7
LRR [sensitive, ls]	378	401	0.092
LRR [sensitive, ls]	378	401	2.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	15	403	3e-41
CLV2 [A. thaliana]	26	404	4e-41
FLS2 [A.thaliana]	31	403	7e-48
Cf-9 [L. pimpinellifolium]	53	405	2e-23
CLV2 [A. thaliana]	65	339	2e-14
Xa21 [O. sativa]	66	405	1e-34
Cf-9 [L. pimpinellifolium]	70	363	9e-26
FLS2 [A.thaliana]	70	392	1e-35
Cf-9 [L. pimpinellifolium]	115	404	6e-30
CLV2 [A. thaliana]	117	404	6e-31
FLS2 [A.thaliana]	117	405	1e-45
Cf-9 [L. pimpinellifolium]	120	405	7e-28
CLV2 [A. thaliana]	120	394	2e-34
CLV2 [A. thaliana]	120	393	5e-22
Xa21 [O. sativa]	120	252	2e-12
Cf-9 [L. pimpinellifolium]	121	394	1e-28
FLS2 [A.thaliana]	124	403	5e-38
FLS2 [A.thaliana]	124	394	1e-36
Xa21 [O. sativa]	124	397	5e-33
Xa21 [O. sativa]	128	395	7e-31
FLS2 [A.thaliana]	235	405	2e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	24	in -> out
putative TM domain	7	24	in -> out

Report for 5876.m00144

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)