Report for 5894.m00147

 > 5894.m00147, length: 705, copies: 1 

MDETSIFGRDKEKNWVISKLTESSIQQNIKIVSVIGLGGSGKTTLAKLVFNDGNTIKQHFELILWVHVSREFDVE

KLVEKLYEAIAGDKPNHLPLQRVSRTISDKLAGKKFLVVMDDVWTEDHAHWEQFMVHLKSGAPGSSILLTARSRK

VAEAVDSTYTFDMPFLSEDNSQKVFEQNLGSAAIGLDPEFLQIGTEIMKKCSGVPLAIKVLAGVLRGMKGIEEWQ

SIRDSNLLDVEDEERKIFACLLLSYIHLPHHLKRCFLHCSIFPRGYVIKRRHLISQWIAHGFIPTNQAQQPEDVG

IGYFDSLLKVGFLQDQEQDHSDEVTCKMHDLIHDLSRKILQDEFVSGIETIDQTKKCRYLSLTSCSGKVDRKLYD

KVRAFYVSRCKLASDRTMNKQRCIRTVILKYMNIDSLHLFVSNFEYMGYLEISNVNCEALPDAISHCWNLKALHV

IKCTRLANLPESIGKLKKLRTLELNVAWNVKSLPQSIGDCDSLGSLYLENCGIKDMPNSIEKLENLRVLSFVYCT

DLQQLLPSEPYGKLRNLQTITLTFCTAFKHLPQCITLLGHLQYVDLSCCTELRELPEGIGALKKLEVLNLERCRR

LCGLPAGCGQLIRLQQLGLFVIGDRTKHARISELEKLDKLNGELQIKNIKHVKDPFDAEMVHLKRKNGIRKLSLD

WSSRWEFGASHMEEKLSVEERTEEELSIIY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
NB-ARC [Pfam ls]	1	293	7e-64
NB-ARC [Pfam fs]	2	293	1.1e-67
LRR [Pfam ls]	492	514	2.9
LRR [Pfam ls]	565	588	0.21
LRR [Pfam ls]	589	612	7.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	444	467	3.8
LRR [sensitive, ls]	444	467	75
LRR [sensitive, ls]	468	491	6.8
LRR [sensitive, ls]	468	491	130
LRR [sensitive, ls]	492	514	0.15
LRR [sensitive, ls]	492	514	2.9
LRR [sensitive, ls]	515	540	5.9
LRR [sensitive, ls]	515	540	120
LRR [sensitive, ls]	541	564	3
LRR [sensitive, ls]	541	564	59
LRR [sensitive, ls]	565	588	0.011
LRR [sensitive, ls]	565	588	0.21
LRR [sensitive, ls]	589	612	0.39
LRR [sensitive, ls]	589	612	7.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Pi-ta [Oryza sativa]	1	362	3e-30
Xa1 [Oryza sativa]	1	501	6e-48
I2 [L. esculentum]	2	519	1e-57
Pib [Oryza sativa].	2	641	1e-34
RPM1 [A. thaliana]	3	652	2e-41
RPS2 [A. thaliana]	5	640	8e-28
Mla1 [Hordeum vulgare].	6	573	4e-40
N [N. glutinosa]	17	615	2e-20
RPP5 [A. thaliana]	30	623	4e-13
RPP5 [A. thaliana]	400	581	5e-11
N [N. glutinosa]	431	592	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5894.m00147

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)