Report for 5910.m00155

 > 5910.m00155, length: 614, copies: 1 

MNAYLRALYLSHCSLTSASQSILQLNFTRLEELDLSHNNFNQPLASCWFWNLTSLKYLDLSGNNIVGSLPAAVSK

FTSLDTLDLSENQLFGSVPYEISMLTSLTDINLRVNNLTGEITEKHLAGLKSLKNIDLSSNHYLKIVVGPEWQPP

FKLEVAIFESCQLGPKFPSWLQWMVDIKILDIWNTGCKQLMHLDLSQSKFHGRLPSWIGDFPAVRSLILNNNVLS

GHIPINITNLTNLQDLDLSQNKFHGRLPNWIGDLPKALFVSWSSQLPHLIFRAHAFQTAKRNHHFVPSNPCDTVP

KLGSGATTVACVPRERDALLAFKRDITSDHLGLLTSWRQDDHDCYRWRGITCSNLTGHVLKLHLSGIYTNEHTGM

EGLVGQISPQLLYLDHLEHLDLSINYLEGPSGQIPEFIGSMKSLRYLKLSGIPFSGTVPSQLGNLSKLQHLDLSD

LEGKEGMHLADMSWVSRLGSLRYLDLSFINLSAASDWAHAVNMIPSIRVLCLSLCQLQGANHSLAHYNLTKLEKL

DLSSNYFDHPYASCWFWNSTILKYLDISSNNLYDQLPNAIGHMASLRVINFSDNAHMGIVEPELMTNLCSLENLN

LQGSLSYGNMTVAR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	29	53	0.1
LRR [Pfam ls]	54	77	0.0021
LRR [Pfam ls]	78	101	3.8
LRR [Pfam ls]	102	126	2.4
LRR [Pfam ls]	213	236	2.1
LRR [Pfam ls]	237	260	0.051
LRR [Pfam ls]	391	417	0.17
LRR [Pfam ls]	418	441	3.6

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	4	26	0.65
LRR [sensitive, ls]	4	26	7.1
LRR [sensitive, ls]	29	53	0.0094
LRR [sensitive, ls]	29	53	0.1
LRR [sensitive, ls]	54	77	0.00019
LRR [sensitive, ls]	54	77	0.0021
LRR [sensitive, ls]	78	101	0.35
LRR [sensitive, ls]	78	101	3.8
LRR [sensitive, ls]	102	126	0.22
LRR [sensitive, ls]	102	126	2.4
LRR [sensitive, ls]	127	162	5.4
LRR [sensitive, ls]	127	162	59
LRR [sensitive, ls]	189	212	0.92
LRR [sensitive, ls]	189	212	10
LRR [sensitive, ls]	213	236	0.19
LRR [sensitive, ls]	213	236	2.1
LRR [sensitive, ls]	237	260	0.0047
LRR [sensitive, ls]	237	260	0.051
LRR [sensitive, ls]	391	417	0.016
LRR [sensitive, ls]	391	417	0.17
LRR [sensitive, ls]	418	441	0.33
LRR [sensitive, ls]	418	441	3.6
LRR [sensitive, ls]	470	491	3.1
LRR [sensitive, ls]	470	491	34
LRR [sensitive, ls]	496	520	4.3
LRR [sensitive, ls]	496	520	47
LRR [sensitive, ls]	521	545	2
LRR [sensitive, ls]	521	545	22
LRR [sensitive, ls]	546	569	0.6
LRR [sensitive, ls]	546	569	6.5
LRR [sensitive, ls]	570	594	1.6
LRR [sensitive, ls]	570	594	18

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	2	585	3e-23
Xa21 [O. sativa]	3	598	2e-20
FLS2 [A.thaliana]	4	589	1e-25
Cf-9 [L. pimpinellifolium]	5	610	5e-22
Cf-9 [L. pimpinellifolium]	5	434	2e-17
Cf-9 [L. pimpinellifolium]	5	253	2e-11
CLV2 [A. thaliana]	5	438	1e-18
FLS2 [A.thaliana]	5	453	3e-18
CLV2 [A. thaliana]	7	585	3e-28
Cf-9 [L. pimpinellifolium]	18	600	2e-18
FLS2 [A.thaliana]	26	611	8e-25
FLS2 [A.thaliana]	26	564	2e-21
FLS2 [A.thaliana]	26	269	2e-14
FLS2 [A.thaliana]	30	585	2e-31
FLS2 [A.thaliana]	30	253	2e-19
FLS2 [A.thaliana]	51	610	6e-25
Xa21 [O. sativa]	51	260	9e-22
Xa21 [O. sativa]	58	585	1e-20
CLV2 [A. thaliana]	187	601	3e-17
CLV2 [A. thaliana]	214	613	8e-12
FLS2 [A.thaliana]	214	605	8e-12
CLV2 [A. thaliana]	313	590	7e-19
FLS2 [A.thaliana]	315	605	3e-14
Xa21 [O. sativa]	318	611	3e-14
Cf-9 [L. pimpinellifolium]	336	601	1e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5910.m00155

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)