Report for 5910.m00164

 > 5910.m00164, length: 949, copies: 1 

MSTAIIIVSTTTSSSFFFFLLLMITTGGGCKPRERDALLAFKEGIVKDPAGLLSSWQRGGHYDDDDDQLLEEDCC

QWRGVRCSNLTGHVVKLNLRNDYADVGTGLVGEIGHSLISLEHLRYLDLSMNNLAGPTGHVPEFLGSFRSLRYLN

LSGIVFSGMVPPQLGKLSNLKFLDFSGMLPSSMAPFLYISDASWLAHLSNLQYLNLNGVNLSTVLDWPHVLNMIP

SLKFLSLSSCSLQSANQYPTQINLRQLEILDLSNNYELSDQAESSWIWSLTSLKYLNLSSTSLYGEIPQALGNML

SLQVLDFSYNMSVSKKGNMCIMKANLKNLCNLEVLDLDYRLAYGEISEIFESLPQCSPNKLKELHLANNNLTGNL

PKLVGRLTSLVTLDLFNNNITGQVPSEIGMLTNLTNLYLHYNCLDGVITEEHFANLTSLKSIYLCYNYLEIVVDP

EWLPPFRLEKAYFASTSMGPSFPSWLQSQVDILELAMSDAGINDTFPDWFSTTFSKATFLEMSQNQIAGGLPTNM

ENMSLEKLYLDCNHIADRIPRMPRNLMLLDISYNLISGDVPQSICELQKLNGLDLSNNLLEGEFPQCSLMSRVSF

FRASNNSFSGNFPSFLQGWTKLSFLDLSWNKFSGTLPTWIGNFNKLEFLQLKHNMFSGSIPDSITNLGKLSHLDL

ASNGLSGPLPQHLSNLTGMMINHDTTKYEERLSGCDYKSFVNMKGQELQYNQEKVTVVTIDLSSNFLTGVIPEGI

VSLDGIINLNLSWNNLNGKIPYMIGAIKSLESLDLSKNNFYGEIPQSLSDLTYLSYLNLSYNNLTGRVPSGTQLC

SLYDQNHHLYDGNDGLCGPPLQKSCYKYDASKQGYQIRSKQGFHIGSFSIGVTVGFMAGLWVVFYILLFKKSWRI

AYFCFLDNMYDEVYVKVIVVWAKLTGRTDERLRMSQVAWSSIDSDEYYE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	118	144	3.5
LRR [Pfam ls]	145	168	4.9
LRR [Pfam ls]	251	276	0.61
LRR [Pfam ls]	277	300	1.2
LRR [Pfam ls]	360	383	0.034
LRR [Pfam ls]	384	407	0.11
LRR [Pfam ls]	408	432	0.12
LRR [Pfam ls]	550	573	3.1
LRR [Pfam ls]	574	596	1.2
LRR [Pfam ls]	621	644	0.97
LRR [Pfam ls]	645	668	0.59
LRR [Pfam ls]	669	692	0.18
LRR [Pfam ls]	779	802	0.025
LRR [Pfam ls]	803	826	1.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	118	144	0.32
LRR [sensitive, ls]	118	144	3.5
LRR [sensitive, ls]	145	168	0.44
LRR [sensitive, ls]	145	168	4.9
LRR [sensitive, ls]	200	222	0.69
LRR [sensitive, ls]	200	222	7.5
LRR [sensitive, ls]	226	245	3.2
LRR [sensitive, ls]	226	245	35
LRR [sensitive, ls]	251	276	0.056
LRR [sensitive, ls]	251	276	0.61
LRR [sensitive, ls]	277	300	0.11
LRR [sensitive, ls]	277	300	1.2
LRR [sensitive, ls]	301	330	3.6
LRR [sensitive, ls]	301	330	40
LRR [sensitive, ls]	360	383	0.0031
LRR [sensitive, ls]	360	383	0.034
LRR [sensitive, ls]	384	407	0.01
LRR [sensitive, ls]	384	407	0.11
LRR [sensitive, ls]	408	432	0.011
LRR [sensitive, ls]	408	432	0.12
LRR [sensitive, ls]	433	457	0.86
LRR [sensitive, ls]	433	457	9.5
LRR [sensitive, ls]	506	526	5.1
LRR [sensitive, ls]	506	526	56
LRR [sensitive, ls]	529	548	1.4
LRR [sensitive, ls]	529	548	15
LRR [sensitive, ls]	550	573	0.28
LRR [sensitive, ls]	550	573	3.1
LRR [sensitive, ls]	574	596	0.11
LRR [sensitive, ls]	574	596	1.2
LRR [sensitive, ls]	597	620	4.9
LRR [sensitive, ls]	597	620	54
LRR [sensitive, ls]	621	644	0.088
LRR [sensitive, ls]	621	644	0.97
LRR [sensitive, ls]	645	668	0.054
LRR [sensitive, ls]	645	668	0.59
LRR [sensitive, ls]	669	692	0.016
LRR [sensitive, ls]	669	692	0.18
LRR [sensitive, ls]	731	754	0.57
LRR [sensitive, ls]	731	754	6.3
LRR [sensitive, ls]	755	778	2.7
LRR [sensitive, ls]	755	778	29
LRR [sensitive, ls]	779	802	0.0023
LRR [sensitive, ls]	779	802	0.025
LRR [sensitive, ls]	803	826	0.14
LRR [sensitive, ls]	803	826	1.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	1	856	7e-77
Xa21 [O. sativa]	16	662	5e-40
CLV2 [A. thaliana]	32	669	2e-41
Cf-9 [L. pimpinellifolium]	74	909	3e-78
CLV2 [A. thaliana]	212	816	2e-47
Xa21 [O. sativa]	244	862	1e-47
CLV2 [A. thaliana]	332	845	4e-36
Xa21 [O. sativa]	358	843	1e-41
Xa21 [O. sativa]	546	820	9e-25

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	in -> out
putative TM domain	872	894	out -> in

Report for 5910.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)