Report for 5910.m00165

 > 5910.m00165, length: 1500, copies: 1 

MCTFIVVLTSIVFLMVTSNGQAQAPIGCIPRERDALLEFKNSITDDPMGQLKFWRRGDDCCQWRGIRCSNRTGHV

IKLQLWKPKFDDDGMSLVGNGMVGLISPSLLSLEHLQHLDLSWNNLSGSDGHIPGFIGSFRNLRYLNLSGMPFIG

VVPPQLGNLSKLQFLDLSSCIGLEMQSRSGMTWLRNIPLLQYLNLNSVDLSAVDNWLHVMNQLPSLRVLNLSNCS

LQRADQKLTHLHNNFTRLERLDLSGNQFNHPAASCWFWNITSLKDLILSGNRLYGQLPDALADMTSLQVLDFSIN

RPVPISPIGLLPSSQAPPSSGDDDAAIEGITIMAENLRNLCSLEILDLTQSLSSGNITELIDNLAKCPASKLQQL

ILKYNNITGILPISMGVFSSLVYLDLSQNYLTGQLPSEIGMLRNLTWMDLSYNGLVHLPPEIGMLTNLAYIDLGH

NNFSHLPSEIGMLSNLGYLDLSFNNLDGVITEKHFAHLASLESIYLPYNSLEIVVDPEWLPPFRLKYAYFYCCQM

GPMFPKWLQTQVDIIELDIANTSIKDTFPEWFWTTVSKATYLDISNNQIRGGLPTNMETMLLETFYLDSNLITGE

IPELPINLETLDISNNYLSGPLPSNIGAPNLAHLNLYSNQISGHIPGYLCNLGALEALDLGNNRFEGELPRCFEM

GVGSLKFLRLSNNRLSGNFPSFLRKCKELHFIDLSWNKLSGILPKWIGDLTELQILRLSHNSFSGDIPRSITKLT

NLHHLDLASNNISGAIPNSLSKILAMIGQPYEGADQTPAASGVNYTSPVATKGQERQYNEENVEVVNIDLSSNFL

TGGIPEDIVSLGGLVNLNLSRNHLSGQIPYKIGAMRMLASLDLSENKLYGEIPASLSSLTFLSYLNLSYNSLTGR

IPSGSQLETIYNQHPDIYNGNSGLCGPPLQKNCSSNNVPKQGSQPVQLLTHTHINLTKLEHLGLSRNYFGHPIAS

SWFWKVRTIKELGLSETYLHGPFPDALGGITSLQQLDFTNNGNAATMTINLKNLCELAALWLDGSLSSGNITEFV

EKLPRCSSPLNILSLQGNNMTGMLPDVMGHINNLSILDLSNNSISGSIPRGIQNLTQLISLTLSSNQLTGHIPVL

PTSLTNFDVAMNFLSGNLPSQFGAPFLRVIILSYNRITGQIPGSICMLQNIFMLDLSNNFLEGELPRCFTMPNLF

FLLLSNNRFSGEFPLCIQYTWSLAFIDLSRNKFYGALPVWIGDLENLRFLQLSHNMFHGNIPVNIANLGSLQYLN

LAANNMSGSIPRTLVNLKAMTLHPTRIDVGWYESLTYYVLLTDILSLVMKHQELNYHAEGSFDLVGIDLSQNQLT

GGIPDQVTCLDGLVNLNLSSNHLKGKIPDNVGDMKSVESLDFSRNNLSGEIPLSLSDLTYLSSLDLSHNKFVGRI

PRGSQLDTLYANNPSMYDGNSGLCGPPLQRNCSSVNAPKHGKQNISVEDTEAVMFFYFGLVSGFVIGLWVVFCAI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	110	136	0.023
LRR [Pfam ls]	137	160	0.22
LRR [Pfam ls]	215	237	0.13
LRR [Pfam ls]	242	264	5
LRR [Pfam ls]	267	290	0.34
LRR [Pfam ls]	371	394	5.2
LRR [Pfam ls]	395	418	0.12
LRR [Pfam ls]	419	441	0.07
LRR [Pfam ls]	442	464	0.1
LRR [Pfam ls]	465	489	0.58
LRR [Pfam ls]	563	583	4.5
LRR [Pfam ls]	607	627	3
LRR [Pfam ls]	630	653	0.029
LRR [Pfam ls]	679	702	0.065
LRR [Pfam ls]	703	726	0.1
LRR [Pfam ls]	727	750	0.042
LRR [Pfam ls]	751	774	0.18
LRR [Pfam ls]	814	837	3.8
LRR [Pfam ls]	838	861	1.5
LRR [Pfam ls]	862	885	0.87
LRR [Pfam ls]	886	908	0.39
LRR [Pfam fs]	1083	1106	4.7e-05
LRR [Pfam ls]	1083	1106	0.00081
LRR [Pfam ls]	1107	1130	0.87
LRR [Pfam ls]	1151	1174	3.4
LRR [Pfam ls]	1175	1197	3.1
LRR [Pfam ls]	1246	1269	0.14
LRR [Pfam ls]	1270	1293	0.4
LRR [Pfam ls]	1362	1385	0.23
LRR [Pfam ls]	1386	1409	0.04

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	110	136	0.0021
LRR [sensitive, ls]	110	136	0.023
LRR [sensitive, ls]	137	160	0.02
LRR [sensitive, ls]	137	160	0.22
LRR [sensitive, ls]	161	188	3.5
LRR [sensitive, ls]	161	188	38
LRR [sensitive, ls]	189	211	4.5
LRR [sensitive, ls]	189	211	49
LRR [sensitive, ls]	215	237	0.011
LRR [sensitive, ls]	215	237	0.13
LRR [sensitive, ls]	242	264	0.46
LRR [sensitive, ls]	242	264	5
LRR [sensitive, ls]	267	290	0.031
LRR [sensitive, ls]	267	290	0.34
LRR [sensitive, ls]	371	394	0.47
LRR [sensitive, ls]	371	394	5.2
LRR [sensitive, ls]	395	418	0.011
LRR [sensitive, ls]	395	418	0.12
LRR [sensitive, ls]	419	441	0.0064
LRR [sensitive, ls]	419	441	0.07
LRR [sensitive, ls]	442	464	0.0094
LRR [sensitive, ls]	442	464	0.1
LRR [sensitive, ls]	465	489	0.053
LRR [sensitive, ls]	465	489	0.58
LRR [sensitive, ls]	490	514	0.75
LRR [sensitive, ls]	490	514	8.2
LRR [sensitive, ls]	538	561	5.7
LRR [sensitive, ls]	538	561	62
LRR [sensitive, ls]	563	583	0.41
LRR [sensitive, ls]	563	583	4.5
LRR [sensitive, ls]	586	605	4.6
LRR [sensitive, ls]	586	605	51
LRR [sensitive, ls]	607	627	0.28
LRR [sensitive, ls]	607	627	3
LRR [sensitive, ls]	630	653	0.0026
LRR [sensitive, ls]	630	653	0.029
LRR [sensitive, ls]	654	676	0.64
LRR [sensitive, ls]	654	676	7
LRR [sensitive, ls]	679	702	0.006
LRR [sensitive, ls]	679	702	0.065
LRR [sensitive, ls]	703	726	0.0094
LRR [sensitive, ls]	703	726	0.1
LRR [sensitive, ls]	727	750	0.0038
LRR [sensitive, ls]	727	750	0.042
LRR [sensitive, ls]	751	774	0.016
LRR [sensitive, ls]	751	774	0.18
LRR [sensitive, ls]	814	837	0.34
LRR [sensitive, ls]	814	837	3.8
LRR [sensitive, ls]	838	861	0.14
LRR [sensitive, ls]	838	861	1.5
LRR [sensitive, ls]	862	885	0.079
LRR [sensitive, ls]	862	885	0.87
LRR [sensitive, ls]	886	908	0.036
LRR [sensitive, ls]	886	908	0.39
LRR [sensitive, ls]	958	982	0.76
LRR [sensitive, ls]	958	982	8.4
LRR [sensitive, ls]	983	1006	1.4
LRR [sensitive, ls]	983	1006	16
LRR [sensitive, ls]	1059	1082	2.4
LRR [sensitive, ls]	1059	1082	26
LRR [sensitive, ls]	1083	1106	7.4e-05
LRR [sensitive, ls]	1083	1106	0.00081
LRR [sensitive, ls]	1107	1130	0.079
LRR [sensitive, ls]	1107	1130	0.87
LRR [sensitive, ls]	1151	1174	0.31
LRR [sensitive, ls]	1151	1174	3.4
LRR [sensitive, ls]	1175	1197	0.28
LRR [sensitive, ls]	1175	1197	3.1
LRR [sensitive, ls]	1198	1220	2.5
LRR [sensitive, ls]	1198	1220	28
LRR [sensitive, ls]	1222	1245	1.1
LRR [sensitive, ls]	1222	1245	12
LRR [sensitive, ls]	1246	1269	0.013
LRR [sensitive, ls]	1246	1269	0.14
LRR [sensitive, ls]	1270	1293	0.037
LRR [sensitive, ls]	1270	1293	0.4
LRR [sensitive, ls]	1338	1361	0.7
LRR [sensitive, ls]	1338	1361	7.7
LRR [sensitive, ls]	1362	1385	0.021
LRR [sensitive, ls]	1362	1385	0.23
LRR [sensitive, ls]	1386	1409	0.0037
LRR [sensitive, ls]	1386	1409	0.04
LRR [sensitive, ls]	1410	1432	0.56
LRR [sensitive, ls]	1410	1432	6.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	3	926	3e-66
Cf-9 [L. pimpinellifolium]	4	948	2e-73
CLV2 [A. thaliana]	30	667	9e-45
Xa21 [O. sativa]	35	670	2e-39
Xa21 [O. sativa]	332	949	6e-54
CLV2 [A. thaliana]	348	938	3e-51
CLV2 [A. thaliana]	415	1048	3e-41
Cf-9 [L. pimpinellifolium]	560	1292	1e-48
FLS2 [A.thaliana]	667	1450	2e-82
Xa21 [O. sativa]	677	1264	1e-48
Cf-9 [L. pimpinellifolium]	678	1497	4e-67
Xa21 [O. sativa]	815	1470	1e-55
CLV2 [A. thaliana]	837	1499	6e-55
Xa21 [O. sativa]	1080	1426	2e-34

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	1477	1499	out -> in

Report for 5910.m00165

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)