Report for 5973.m00146

 > 5973.m00146, length: 807, copies: 2 

MAEALVFVVLQKIGAILGGQVLNEIRSQFGKKSLIFEVENSVMELASEFRVMQAFINHVGMCSHQNAAYEAWLDE

VKSVGFDAEDIIEEYAYLIAQTSNEGGLIKSVLHRSINAWCHIATQLKQIEARLQKLTAMKDRYGILISEQKLGS

NPSHDDLKLMSDSLYFYSQDDIVGNEEELAWITQRLIQGRKSRTVISICGMGGGRVIITTRNEDVAILADEDHCI

MLKTLQWKEAWNLFSRKAFPSRKENQCPESVVQWAEKIVDKCKGLPLAIVAIGSLLSHKKKEENEWKLFYNQLNW

QLINNPELNFVIAVLNLSFEYLPSNLKYCFLYCGLFPEDYLIKRKQIIRFWIAEGFVEETGANITMEELAEEYLK

ELAQRSLLHVAERNVYGRAKSFQMHNLVRDMVVSKCKTYKFSDLVVDHCVTKHKYKTRRISVLEADHASEAPTYG

EKVRSFILFDKKVPYSWLETASRDFRLLRVLSLRRASIHKVPDVVSNLFNLRYLDLAYTRVKVIPRSLCRLNKLQ

MLDLWFTGVVELPREIKLLTEIRYMVATVMSEDNHRIFNCFLPVRFPCEVCHLKDLQVLGYIEASKDMISNLRNL

NQLRNLFMMKVEHNYLTELWASIKRMPNLVRLDIISCDSDEVFNMEHLDPLPELETFHLRAKLQDGVLPKMFHGL

VKIRDLEMGWSGLQVDPVCTFSHMSNLTELRLYRVYEGVLLSFQAGLFPKLKKLSLADMENLTWIEMEDGTMQSL

NFIALIGLRNLKVVPEGFQYLMSLQEMFLQDMPQEFIKRAQREDRVYIQHIPKIRKF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
NB-ARC [Pfam ls]	99	362	1.8e-26
NB-ARC [Pfam fs]	205	362	1.7e-53
LRR [Pfam ls]	500	522	0.39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	477	499	0.83
LRR [sensitive, ls]	477	499	21
LRR [sensitive, ls]	500	522	0.015
LRR [sensitive, ls]	500	522	0.39
LRR [sensitive, ls]	523	545	0.27
LRR [sensitive, ls]	523	545	6.9
LRR [sensitive, ls]	677	700	2
LRR [sensitive, ls]	677	700	51
LRR [sensitive, ls]	725	751	2.1
LRR [sensitive, ls]	725	751	53

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
RPM1 [A. thaliana]	200	807	2e-87
I2 [L. esculentum]	203	584	2e-33
Mla1 [Hordeum vulgare].	203	710	2e-32
Xa1 [Oryza sativa]	203	647	1e-26
RPS2 [A. thaliana]	205	540	2e-27
Pib [Oryza sativa].	205	578	3e-37
Pi-ta [Oryza sativa]	205	609	6e-26

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End
putative coiled-coil	119	139

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5973.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)