Report for 5974.m00227

 > 5974.m00227, length: 929, copies: 1 

MAAAAVHVLLLLLPLATITSASSAPLPLLALLSLRSSLGDPAGALRSWTYAAAASAGATRSLAPPWCAWPGVACD

GATGEVVGVDLSRRNLSGTVSPTAARLLSPTLTSLNLSGNAFAGELPPAVLLLRRLVALDVSHNFFNSTFPDGIA

KLGSLAFLDAFSNCFVGELPRGIGELRRLEHLNLGGSFFNGSIPGEVGQLRRLRFLHLAGNALSGRLPRELGELT

SVEHLEIGYNAYDGGIPPEFGKMAQLRYLDIAAANVSGPLPPELGELTRLESLFLFKNRIAGAIPPRWSRLRALQ

VLDVSDNHLAGAIPAGLGELTNLTTLNLMSNSLSGTIPAAIGALPSLEVLQLWNNSLAGRLPESLGASRRLVRLD

VSTNSLSGPIPPGVCAGNRLARLILFDNRFDSAIPASLADCSSLWRVRLEANRLSGEIPAGFGAIRNLTYMDLSS

NSLTGGGIPADLVASPSLEYFNVSGNLVGGALPDMAWRGPKLQVFAASRCGLVGELPAFGATGCANLYRLELAGN

ALGGGIPGDIGSCKRLVSLRLQHNELTGEIPAAIAALPSITEVDLSWNALTGTVPPGFTNCTTLETFDVSFNHLA

PAEPSSDAGERGSPARHTAAMWVPAVAVAFAGMVVLAGTARWLQWRGGDDTAAADALGPGGARHPDLVVGPWRMT

AFQRLSFTADDVARCVEGSDGIVGAGSSGTVYRAKMPNGEVIAVKKLLDELLHGAAAKARPGWDARYKIAVGVAQ

GVSYLHHDCLPAIAHRDIKPSNILLDDDMEARVADFGVAKALQSAAPMSVVAGSCGYIAPEYTYTLKVNEKSDVY

SFGVVLLEILTGRRSVEAEYGEGNNIVDWVRRKVAGGGVGDVIDAAAWADNDVGGTRDEMALALRVALLCTSRCP

QERPSMREVLSMLQEARPKRKNSAKKQVK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	106	129	0.56
LRR [Pfam ls]	178	201	4.6
LRR [Pfam ls]	202	225	0.07
LRR [Pfam ls]	274	297	6.1
LRR [Pfam ls]	298	321	0.23
LRR [Pfam ls]	322	345	0.12
LRR [Pfam ls]	346	369	4.9
LRR [Pfam ls]	442	466	0.16
LRR [Pfam ls]	516	539	0.52
LRR [Pfam ls]	540	563	0.028
LRR [Pfam ls]	564	587	0.074
Ser/Thr pkinase [Pfam ls]	692	915	6e-13
Ser/Thr pkinase [Pfam fs]	696	725	0.011
Ser/Thr pkinase [Pfam fs]	743	837	6.1e-25

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	106	129	0.021
LRR [sensitive, ls]	106	129	0.56
LRR [sensitive, ls]	130	153	0.29
LRR [sensitive, ls]	130	153	7.7
LRR [sensitive, ls]	154	177	1.5
LRR [sensitive, ls]	154	177	39
LRR [sensitive, ls]	178	201	0.17
LRR [sensitive, ls]	178	201	4.6
LRR [sensitive, ls]	202	225	0.0026
LRR [sensitive, ls]	202	225	0.07
LRR [sensitive, ls]	226	249	3.2
LRR [sensitive, ls]	226	249	85
LRR [sensitive, ls]	250	273	0.41
LRR [sensitive, ls]	250	273	11
LRR [sensitive, ls]	274	297	0.23
LRR [sensitive, ls]	274	297	6.1
LRR [sensitive, ls]	298	321	0.0088
LRR [sensitive, ls]	298	321	0.23
LRR [sensitive, ls]	322	345	0.0044
LRR [sensitive, ls]	322	345	0.12
LRR [sensitive, ls]	346	369	0.19
LRR [sensitive, ls]	346	369	4.9
LRR [sensitive, ls]	370	391	0.56
LRR [sensitive, ls]	370	391	15
LRR [sensitive, ls]	394	417	0.99
LRR [sensitive, ls]	394	417	26
LRR [sensitive, ls]	418	441	0.81
LRR [sensitive, ls]	418	441	21
LRR [sensitive, ls]	442	466	0.0062
LRR [sensitive, ls]	442	466	0.16
LRR [sensitive, ls]	467	491	0.27
LRR [sensitive, ls]	467	491	7.1
LRR [sensitive, ls]	516	539	0.02
LRR [sensitive, ls]	516	539	0.52
LRR [sensitive, ls]	540	563	0.0011
LRR [sensitive, ls]	540	563	0.028
LRR [sensitive, ls]	564	587	0.0028
LRR [sensitive, ls]	564	587	0.074

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	13	584	1e-54
Xa21 [O. sativa]	29	580	1e-57
FLS2 [A.thaliana]	30	604	1e-77
Cf-9 [L. pimpinellifolium]	67	604	9e-45
FLS2 [A.thaliana]	76	919	1e-91
Xa21 [O. sativa]	76	266	3e-20
CLV2 [A. thaliana]	80	579	4e-45
Cf-9 [L. pimpinellifolium]	81	388	2e-26
Xa21 [O. sativa]	84	532	1e-44
Cf-9 [L. pimpinellifolium]	92	604	2e-42
Xa21 [O. sativa]	93	363	1e-33
FLS2 [A.thaliana]	106	606	2e-63
Xa21 [O. sativa]	178	606	7e-57
CLV2 [A. thaliana]	277	608	1e-34
Rpg1 [Hordeum vulgare]	723	913	3e-19
Pto [L. esculentum]	738	916	6e-23
Rpg1 [Hordeum vulgare]	738	915	3e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out

Report for 5974.m00227

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)