Report for 5992.m00122

 > 5992.m00122, length: 631, copies: 1 

MAGELNNLCSLEILDLTNMEITGDMTMLIDGLSSQCAARKKLLELHLSYNNFTGALPNSIRRFTSLRMLDISSNN

LIGSISPGIGDLTSLVSLDLSYNDISGHLPTEVMHLLSLASLDLSSNRLSGSIPAEIGVLTNLTSLVLRNNTFSG

VIREEHFAGLISLKNIDLSSNYLKFSMDSDWLPPFRLESAWLASCQIGPLFPSWLQWQHKIIEFDISSTGLMGKI

PDWFWSTFSQATYLDMSQNQISGSLPAHLGTLPPHLEAPELQTLLMYSNRIGGNIPQSICELQLLGDIDLSGNLL

VGEIPQCSEISYNFLLLSNNTLSGKFPAFLQNCTGLQFLDLAWNKFFGSLPAWIGDFRDLQILRLSHNTFSGSIP

AGITNLLSLQYLDLSDNNISGAIPWHLSNLTGMTMKGFQPFSGASMSSGLVTVELSGEIPNKIGTLQSLESLDLS

KNKLSGGIPSSLSSLAFLSYLNLSYNNLSGMIPSGRQLDTLSANDPSLMYIGNEGLCGPPLQKNCSRNYTFIHSS

KQEFKPMTFYFGFGIGLVVGIWVVFCVLLFNKIWRIAYFRLFDKLYDRVYVFLVGGTRMRKEEALSIAGHARKLL

AAAVPAFCTGVIGARRRRRRTGGTAMVGQRR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	41	64	0.2
LRR [Pfam ls]	65	88	0.061
LRR [Pfam ls]	89	112	0.31
LRR [Pfam ls]	113	136	0.008
LRR [Pfam ls]	137	161	1.4
LRR [Pfam ls]	162	186	3.8
LRR [Pfam ls]	235	258	0.53
LRR [Pfam ls]	265	288	6.9
LRR [Pfam ls]	359	382	0.36
LRR [Pfam fs]	383	406	1.5e-05
LRR [Pfam ls]	383	406	0.00023
LRR [Pfam ls]	443	466	0.0055
LRR [Pfam ls]	467	489	2.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	10	33	1
LRR [sensitive, ls]	10	33	21
LRR [sensitive, ls]	41	64	0.0097
LRR [sensitive, ls]	41	64	0.2
LRR [sensitive, ls]	65	88	0.0029
LRR [sensitive, ls]	65	88	0.061
LRR [sensitive, ls]	89	112	0.015
LRR [sensitive, ls]	89	112	0.31
LRR [sensitive, ls]	113	136	0.00039
LRR [sensitive, ls]	113	136	0.008
LRR [sensitive, ls]	137	161	0.066
LRR [sensitive, ls]	137	161	1.4
LRR [sensitive, ls]	162	186	0.18
LRR [sensitive, ls]	162	186	3.8
LRR [sensitive, ls]	210	234	3.9
LRR [sensitive, ls]	210	234	81
LRR [sensitive, ls]	235	258	0.026
LRR [sensitive, ls]	235	258	0.53
LRR [sensitive, ls]	265	288	0.33
LRR [sensitive, ls]	265	288	6.9
LRR [sensitive, ls]	289	311	1.5
LRR [sensitive, ls]	289	311	31
LRR [sensitive, ls]	335	358	0.51
LRR [sensitive, ls]	335	358	11
LRR [sensitive, ls]	359	382	0.017
LRR [sensitive, ls]	359	382	0.36
LRR [sensitive, ls]	383	406	1.1e-05
LRR [sensitive, ls]	383	406	0.00023
LRR [sensitive, ls]	443	466	0.00027
LRR [sensitive, ls]	443	466	0.0055
LRR [sensitive, ls]	467	489	0.11
LRR [sensitive, ls]	467	489	2.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	2	152	2e-13
FLS2 [A.thaliana]	4	483	1e-47
FLS2 [A.thaliana]	4	527	2e-45
CLV2 [A. thaliana]	5	306	4e-16
Xa21 [O. sativa]	5	508	3e-47
CLV2 [A. thaliana]	8	515	2e-35
FLS2 [A.thaliana]	14	497	4e-57
Cf-9 [L. pimpinellifolium]	19	570	6e-49
FLS2 [A.thaliana]	29	483	1e-47
FLS2 [A.thaliana]	36	508	5e-45
Xa21 [O. sativa]	41	483	1e-42
CLV2 [A. thaliana]	48	484	2e-44
Cf-9 [L. pimpinellifolium]	58	484	3e-33
Cf-9 [L. pimpinellifolium]	90	483	9e-26
FLS2 [A.thaliana]	264	483	3e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	533	555	out -> in

Report for 5992.m00122

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)