Report for 6009.m00141

 > 6009.m00141, length: 977, copies: 1 

MVINLSSPPIFLLFFLWCVVVFFVAGDGGAVVAEAALDAQAAYLSQMKQEFAGPAMARWDFSAPAVDYCKFQGVG

CDASGNVTAIDVTSWRLSGRLPGGVCEALPALREVRLGYNDIRGGFPGGLVNCTSLEVLNLSCSGVSGAVPDLSR

MPALRVLDVSNNYFSGAFPTSIANVTTLEVANFNENPGFDIWWPPESLMALRRLRVLILSTTCMHGGVPAWLGNM

TSLTDLELSGNLLTGHIPLSLARLPNLQLLELYYNLLEGVVPAELGNLTQLTDIDLSENNLTGGIPESICALPRL

RVLQMYTNKLTGAIPAVLGNSTQLRILSVYRNQLTGELPADLGRYSGFNVLEVSENQLTGPLPPYACANGQLQYI

LVLSNLLTGAIPASYAACRPLLRFRVSNNHLDGDVPAGIFALPHASIIDLSYNHLTGPVPATIAGATNLTSLFAS

NNRMSGVLPPEIAGAATLVKIDLSNNQIGGAIPEAVGRLSRLNQLSLQGNRLNGSIPATLADLHSLNVLNLSYNA

LAGEIPEALCTLLPNSLDFSNNNLSGPVPLQLIREGLLESVAGNPGLCVAFRLNLTDPALPLCPKPARLRMRGLA

GSVWVVAVCALVCVVATLALARRWVLRARQDGEHDGLPTSPASSSSYDVTSFHKLSFDQHEIVEALIDKNIVGHG

GSGTVYKIELSNGELVAVKKLWVSRRSKQEHGHGGGGGCLDRELRTEVETLGSIRHKNIVKLYCCYSGADSNLLV

YEYMPNGNLWDALHGGGGWGFGFLDWPTRHRVALGVAQGLAYLHHDLLFPIVHRDIKSSNILLDADFEPKVADFG

IAKVLQARGDRDASTTTIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMELATGKKPIEPEFGDTRDIVQWVSGK

VAAGGEGEALDKRLEWSPFKEEMVQALRVAVRCTCSIPGLRPTMADVVQMLAEAGPAAGRTAKDAANKKDSSGEP

KL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	130	152	1.2
LRR [Pfam ls]	153	176	4.1
LRR [Pfam ls]	227	250	0.022
LRR [Pfam ls]	251	274	0.018
LRR [Pfam ls]	275	298	0.01
LRR [Pfam ls]	299	322	1.6
LRR [Pfam ls]	323	346	1.3
LRR [Pfam ls]	443	466	4.8
LRR [Pfam ls]	467	490	0.16
LRR [Pfam ls]	491	514	0.91
LRR [Pfam ls]	515	539	0.092
Ser/Thr pkinase [Pfam fs]	666	882	8.7e-56
Ser/Thr pkinase [Pfam ls]	666	953	9.2e-54

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	106	129	0.4
LRR [sensitive, ls]	106	129	9.1
LRR [sensitive, ls]	130	152	0.053
LRR [sensitive, ls]	130	152	1.2
LRR [sensitive, ls]	153	176	0.18
LRR [sensitive, ls]	153	176	4.1
LRR [sensitive, ls]	203	226	0.95
LRR [sensitive, ls]	203	226	21
LRR [sensitive, ls]	227	250	0.00099
LRR [sensitive, ls]	227	250	0.022
LRR [sensitive, ls]	251	274	0.00082
LRR [sensitive, ls]	251	274	0.018
LRR [sensitive, ls]	275	298	0.00045
LRR [sensitive, ls]	275	298	0.01
LRR [sensitive, ls]	299	322	0.073
LRR [sensitive, ls]	299	322	1.6
LRR [sensitive, ls]	323	346	0.057
LRR [sensitive, ls]	323	346	1.3
LRR [sensitive, ls]	347	371	1.5
LRR [sensitive, ls]	347	371	34
LRR [sensitive, ls]	419	442	0.51
LRR [sensitive, ls]	419	442	12
LRR [sensitive, ls]	443	466	0.22
LRR [sensitive, ls]	443	466	4.8
LRR [sensitive, ls]	467	490	0.007
LRR [sensitive, ls]	467	490	0.16
LRR [sensitive, ls]	491	514	0.041
LRR [sensitive, ls]	491	514	0.91
LRR [sensitive, ls]	515	539	0.0041
LRR [sensitive, ls]	515	539	0.092

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	7	764	4e-65
FLS2 [A.thaliana]	15	554	3e-69
Cf-9 [L. pimpinellifolium]	54	554	3e-39
Cf-9 [L. pimpinellifolium]	70	564	7e-42
CLV2 [A. thaliana]	79	584	2e-43
Cf-9 [L. pimpinellifolium]	80	315	2e-18
Cf-9 [L. pimpinellifolium]	81	534	2e-38
FLS2 [A.thaliana]	81	566	6e-63
FLS2 [A.thaliana]	104	964	1e-100
CLV2 [A. thaliana]	122	554	7e-47
FLS2 [A.thaliana]	201	596	9e-51
CLV2 [A. thaliana]	223	566	2e-36
FLS2 [A.thaliana]	368	557	1e-18
Pto [L. esculentum]	636	954	3e-33
Rpg1 [Hordeum vulgare]	644	955	2e-29
Rpg1 [Hordeum vulgare]	660	951	2e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	10	32	out -> in
putative TM domain	599	621	in -> out

Report for 6009.m00141

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)