Report for 6021.m00140

 > 6021.m00140, length: 827, copies: 1 

MKAGLRSLNLSSSQLSMPLSNFSGFPLLEVLDLSFNSFSGDVRTQLSSLLKLRSLNLSSNNLAGDVPTSMTPSLE

ELVLSINNFSGSIPIALFNYQNLTMLDLSQNNLNGDVPDEFLKLPKLKTLLLSGNQLSGNIPVSVSNVASLARFA

ANQNNFTGFIPSGITKNVKMLDLSYNELSGVIPSDILSPVGLWTVDLTHNKLEGPIPSSLSPTLYRLRLGGGNSL

NGTIPATIGDASTLAYLELDSNQLTGSIPLELGRCKSLSLLNLASNKFQGPVPDAISSLDKLVVLKLQMNNLDGP

IPSVFSNLTSLITLNLSGNSFTGGIPREIGKLPKLSILNLQCNKISGTIPDSLHLLTSLIELNLGNNILTGTIPT

MPTKLSTVLNLSHNNLSGSIPSNIDLLSDLEILDLSYNNLYGEVPASLAKLESLTQLVLSYNHLSGSIPIFRQHV

DIATNGNPDLTNGTRNYDNAPTSGKRRTHNTVIIVVAITGALVGLCLLAAIVTISYSKRIYRVEDEGPSTEDVAR

IINGHLITMNSIHTSAIDFVKAMEAVSNHSNIFLKTRFCTYYKAVMPNGSTYSLKQINCSDKIFQIGSQGKVAHE

LEVLGKLSNSNVMVPLAYVLTEDNAYIIYEHVHKGTVFDFLHAGRSDVLDWPSRYSIAFGLAQGLTFLHGCTQPV

LLLDLSTRTVHLKSMNEPQIGDVELYKIVDTLKSSGSLSTIAGTVGYIPPEYAYTMRLTMAGNVYSFGVILLELL

TGKPSVSDGIELAKWALSLSGSPDQREQILDTRVSRTSAAVHSQMLSVLNIALACVALSPDARPKMRTVLRMLFN

AK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	4	26	1.5
LRR [Pfam ls]	51	71	1.1
LRR [Pfam ls]	97	120	0.012
LRR [Pfam ls]	121	145	1.1
LRR [Pfam ls]	167	190	1.6
LRR [Pfam ls]	238	261	0.7
LRR [Pfam ls]	262	285	0.51
LRR [Pfam ls]	286	309	1.8
LRR [Pfam ls]	310	333	0.0087
LRR [Pfam ls]	334	357	0.059
LRR [Pfam ls]	380	403	6.1
LRR [Pfam ls]	404	427	0.28
LRR [Pfam ls]	428	450	0.87
Ser/Thr pkinase [Pfam ls]	563	825	2.1e-09
Ser/Thr pkinase [Pfam fs]	600	671	0.0071
Ser/Thr pkinase [Pfam fs]	739	755	0.024

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	4	26	0.066
LRR [sensitive, ls]	4	26	1.5
LRR [sensitive, ls]	27	50	0.46
LRR [sensitive, ls]	27	50	10
LRR [sensitive, ls]	51	71	0.047
LRR [sensitive, ls]	51	71	1.1
LRR [sensitive, ls]	73	96	0.29
LRR [sensitive, ls]	73	96	6.5
LRR [sensitive, ls]	97	120	0.00054
LRR [sensitive, ls]	97	120	0.012
LRR [sensitive, ls]	121	145	0.05
LRR [sensitive, ls]	121	145	1.1
LRR [sensitive, ls]	167	190	0.071
LRR [sensitive, ls]	167	190	1.6
LRR [sensitive, ls]	191	214	0.49
LRR [sensitive, ls]	191	214	11
LRR [sensitive, ls]	238	261	0.031
LRR [sensitive, ls]	238	261	0.7
LRR [sensitive, ls]	262	285	0.023
LRR [sensitive, ls]	262	285	0.51
LRR [sensitive, ls]	286	309	0.082
LRR [sensitive, ls]	286	309	1.8
LRR [sensitive, ls]	310	333	0.00039
LRR [sensitive, ls]	310	333	0.0087
LRR [sensitive, ls]	334	357	0.0026
LRR [sensitive, ls]	334	357	0.059
LRR [sensitive, ls]	358	377	0.4
LRR [sensitive, ls]	358	377	9
LRR [sensitive, ls]	380	403	0.27
LRR [sensitive, ls]	380	403	6.1
LRR [sensitive, ls]	404	427	0.012
LRR [sensitive, ls]	404	427	0.28
LRR [sensitive, ls]	428	450	0.039
LRR [sensitive, ls]	428	450	0.87

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	445	7e-59
CLV2 [A. thaliana]	2	445	1e-44
Cf-9 [L. pimpinellifolium]	3	468	1e-39
CLV2 [A. thaliana]	3	443	1e-47
Cf-9 [L. pimpinellifolium]	5	448	4e-49
CLV2 [A. thaliana]	5	279	2e-21
FLS2 [A.thaliana]	5	827	2e-84
Xa21 [O. sativa]	5	647	3e-67
Cf-9 [L. pimpinellifolium]	8	452	7e-41
FLS2 [A.thaliana]	9	444	8e-62
CLV2 [A. thaliana]	22	443	1e-47
CLV2 [A. thaliana]	28	333	2e-35
FLS2 [A.thaliana]	40	444	5e-60
Cf-9 [L. pimpinellifolium]	73	469	2e-42
FLS2 [A.thaliana]	97	444	4e-50
FLS2 [A.thaliana]	155	444	2e-36
Xa21 [O. sativa]	168	455	4e-33
FLS2 [A.thaliana]	242	473	3e-24
Xa21 [O. sativa]	286	444	5e-25
Pto [L. esculentum]	535	820	4e-21
Rpg1 [Hordeum vulgare]	541	825	2e-18
Rpg1 [Hordeum vulgare]	542	823	2e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	482	504	out -> in

Report for 6021.m00140

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)