Report for 6025.m00164

 > 6025.m00164, length: 251, copies: 2 

MGAKFAEAKVSAVVLTGLVALATLVSCNTEGDILYKQKVAWEDPENVLQTWDPTLHNPCTWMHITCNNDNSVIRV

DLLNVLISGPLIPQLGGLKNLQYLQLYGSRLNGSIPATLGKLKHLVSLDLSNNLLTGAIPPSLGAISNLLILRLS

GNNLTGAIPPSLGNLKSLEILELGNNALSGSIPASLGDIETLNYLDLNDNMLTGTVPLEILSRLVTTLDELNVAH

NDLYGTTRKSVTRVTTVVHDMPKTSN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	95	118	0.042
LRR [Pfam ls]	119	142	0.018
LRR [Pfam ls]	143	166	0.0023
LRR [Pfam ls]	167	190	0.34
LRR [Pfam ls]	191	215	0.056

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	0.0038
LRR [sensitive, ls]	95	118	0.042
LRR [sensitive, ls]	119	142	0.0016
LRR [sensitive, ls]	119	142	0.018
LRR [sensitive, ls]	143	166	0.00021
LRR [sensitive, ls]	143	166	0.0023
LRR [sensitive, ls]	167	190	0.031
LRR [sensitive, ls]	167	190	0.34
LRR [sensitive, ls]	191	215	0.0051
LRR [sensitive, ls]	191	215	0.056

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	38	231	3e-15
FLS2 [A.thaliana]	43	243	3e-24
Xa21 [O. sativa]	48	231	2e-27
Cf-9 [L. pimpinellifolium]	58	243	5e-14
Xa21 [O. sativa]	61	243	2e-21
FLS2 [A.thaliana]	68	239	8e-25
FLS2 [A.thaliana]	70	232	1e-17
FLS2 [A.thaliana]	71	244	3e-24
CLV2 [A. thaliana]	72	231	5e-22
Cf-9 [L. pimpinellifolium]	74	243	1e-20
CLV2 [A. thaliana]	74	242	1e-10
Xa21 [O. sativa]	74	230	7e-15
Cf-9 [L. pimpinellifolium]	75	196	5e-11
CLV2 [A. thaliana]	75	207	2e-11
FLS2 [A.thaliana]	75	243	1e-22
FLS2 [A.thaliana]	75	230	4e-18
Xa21 [O. sativa]	75	185	5e-13
FLS2 [A.thaliana]	76	235	9e-21
CLV2 [A. thaliana]	81	207	3e-18
FLS2 [A.thaliana]	81	240	7e-19
Cf-9 [L. pimpinellifolium]	82	230	3e-14
FLS2 [A.thaliana]	82	242	5e-22
FLS2 [A.thaliana]	82	239	9e-21
FLS2 [A.thaliana]	82	230	4e-19
FLS2 [A.thaliana]	83	236	2e-15
FLS2 [A.thaliana]	87	222	2e-16
Cf-9 [L. pimpinellifolium]	96	234	6e-12
Xa21 [O. sativa]	97	207	2e-15
CLV2 [A. thaliana]	99	233	4e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6025.m00164

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)