Report for 6109.m00090

 > 6109.m00090, length: 485, copies: 1 

MFAVIRARRSSLPVGIPKLPRVRQRELMNFSFIELEAATHNFATTIGQGGSGTVYKGVLSDGVQVAIKKHTDGFP

SQYDEMPKKHPLILLRSMLEHKNIVKLVGYCHEYREIEMPKENATNGNVSAKEEFLLLVEEYMTNGNLGNLIYGG

LLDWSSRLKIIEGITQGVVYLHTHSEKPIVHLDLKPDNILLDSNMNPKIGDFGLSEELQDDYINASVSGTLGYMP

PEYIIEGTVSLKNDVYGFGVTLLETISGMSESGRGARHQASIEWAWNVRLSGGMNKLFDPRLCDESQLKEIKRCM

DIGLLCTQNKATERPTMQDVLKMIQGKKKVPTPKQPGYIKRARAAGPLYSSIAFLCNPKVGQVFYCACCQMTDYR

GFSLCGIKKDGVCLCATKKFEPPSLPSSNFIALSTPFRPFFVVTYYQWEDKMVDTGVQTPHAPTPIHAVPLMAVA

PLGGFPTAAPLAIMQEGSQAAGIVGNAQVGNRVMQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
Ser/Thr pkinase [Pfam ls]	40	326	6.7e-38
Ser/Thr pkinase [Pfam fs]	45	253	5.9e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Rpg1 [Hordeum vulgare]	17	322	2e-33
FLS2 [A.thaliana]	26	321	8e-28
Pto [L. esculentum]	26	321	7e-42
Rpg1 [Hordeum vulgare]	30	321	4e-41

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6109.m00090

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)