Report for 6147.m00136

 > 6147.m00136, length: 1033, copies: 1 

MATLNTQTLITLFLLLLLAAAAAAADAGGGGEREALLRSWRSTSRPPRAAASRGALSPAVAALRGLRVLALPSHA

LSGQLPAAIWSLRRLLVLDLSGNRLQGEIPPALACAGLQTLDLSYNQLNGSVPASLGALPGLRRLSLASNRLGGA

IPDELGGAGCRSLQYLDLSGNLLVGGIPRSLGNCSKLEALLLSSNLLDDVIPPEIGRLRNLRALDVSRNSLSGSV

PAELGGCVELSVLVLSNPYTPIGGSNSSDYGDVDDFNYFQGGIPDAVVALPKLRVLWAPRATLEGELPRNWSACQ

SLEMINLGENLFSGGIPNGLVECSHLKFLNLSSNKLTGAIDPSLTVPCMDVFDVSGNRFSGAMPVFEQKGCPSSQ

LPFDDLVSEYSSFFSYQALAGFRSSSFVLGTDLTSYHSFAQNNFTGPVKSLPLAADKLGMQGSYAFLADGNNIAG

QLQPDLFSKCNSSRGFIVDVSNNLITGGIPVEIGSLCSSLVVLGVAGNQLSGLIPTSIGQLNYLISLDLSRNHLG

GEIPTSVKNLPNLERLSLGHNFLNGTIPTEINQLYSLKVLDLSSNLLTGEIPGALADLRNLTALLLDNNKLTGKI

PSAFAKSMSLTMFNLSFNNLSGPVPANSNTVRCDSVIGNPLLQSCHMYTLAVPSAAQQGRGLNSNDYNDTSSADS

QNQGGSNSFNAIEIASITSATAIVSVLLALIVLFIYTRKCAPRMSSRSSRRREVITFQDIGVPITYETVVRATGS

FNASNCIGSGGFGATYKAEISPGVLVAIKRLSVGRFQGVQQFHAEIKTLGRLRHPNLVTLVGYHLGESEMFLIYN

YLPGGNLERFIQERSKRPVDWKMLHKIALDIAKALAYLHDTCVPRILHRDVKPSNILLDTEYNAYLSDFGLARLL

GNSETHATTGVAGTFGYVAPEYAMTCRVSDKADVYSYGVVLMELISDKKALDPSFSPYGNGFNIVAWACMLLRQG

RAREFFIDGLWDVGPHDDLVETLHLAVMCTVDSLSVRPTMKQVVQRLKQLQPPIREHR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	89	109	0.11
LRR [Pfam ls]	112	135	0.023
LRR [Pfam ls]	136	159	5.1
LRR [Pfam ls]	162	185	0.0042
LRR [Pfam ls]	186	209	3.2
LRR [Pfam ls]	210	233	0.15
LRR [Pfam ls]	325	345	0.19
LRR [Pfam ls]	489	512	0.75
LRR [Pfam ls]	513	536	0.55
LRR [Pfam ls]	537	560	4
LRR [Pfam ls]	561	584	0.0037
LRR [Pfam ls]	585	608	0.39
Ser/Thr pkinase [Pfam fs]	751	946	3.5e-48
Ser/Thr pkinase [Pfam ls]	751	1025	5e-42

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	89	109	0.0054
LRR [sensitive, ls]	89	109	0.11
LRR [sensitive, ls]	112	135	0.0011
LRR [sensitive, ls]	112	135	0.023
LRR [sensitive, ls]	136	159	0.25
LRR [sensitive, ls]	136	159	5.1
LRR [sensitive, ls]	162	185	0.0002
LRR [sensitive, ls]	162	185	0.0042
LRR [sensitive, ls]	186	209	0.15
LRR [sensitive, ls]	186	209	3.2
LRR [sensitive, ls]	210	233	0.0074
LRR [sensitive, ls]	210	233	0.15
LRR [sensitive, ls]	301	321	0.43
LRR [sensitive, ls]	301	321	8.8
LRR [sensitive, ls]	325	345	0.009
LRR [sensitive, ls]	325	345	0.19
LRR [sensitive, ls]	489	512	0.036
LRR [sensitive, ls]	489	512	0.75
LRR [sensitive, ls]	513	536	0.027
LRR [sensitive, ls]	513	536	0.55
LRR [sensitive, ls]	537	560	0.19
LRR [sensitive, ls]	537	560	4
LRR [sensitive, ls]	561	584	0.00018
LRR [sensitive, ls]	561	584	0.0037
LRR [sensitive, ls]	585	608	0.019
LRR [sensitive, ls]	585	608	0.39
LRR [sensitive, ls]	609	630	0.92
LRR [sensitive, ls]	609	630	19

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	43	357	5e-29
Xa21 [O. sativa]	48	849	1e-66
FLS2 [A.thaliana]	50	637	1e-52
CLV2 [A. thaliana]	51	314	6e-14
Cf-9 [L. pimpinellifolium]	53	357	1e-27
Cf-9 [L. pimpinellifolium]	54	529	2e-25
CLV2 [A. thaliana]	54	600	4e-43
FLS2 [A.thaliana]	54	1026	4e-91
FLS2 [A.thaliana]	54	671	3e-60
Cf-9 [L. pimpinellifolium]	56	601	1e-27
Cf-9 [L. pimpinellifolium]	63	645	2e-32
CLV2 [A. thaliana]	66	588	3e-37
CLV2 [A. thaliana]	69	627	8e-35
CLV2 [A. thaliana]	89	632	2e-34
CLV2 [A. thaliana]	186	626	4e-40
Xa21 [O. sativa]	490	641	2e-25
Pto [L. esculentum]	731	1023	1e-41
Rpg1 [Hordeum vulgare]	741	1025	3e-30
Rpg1 [Hordeum vulgare]	748	1025	7e-23

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	9	31	in -> out
putative TM domain	689	711	out -> in

Report for 6147.m00136

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)