Report for 6149.m00367

 > 6149.m00367, length: 745, copies: 1 

MAMAGKATAFDVLRGLKRRVDRCRRQYAPWLPWKLDEALSVGVNPTLSLLLDMLLLPPPAPVPGDELGTIKGALY

ELEDLLDDLDEHAGRNNDAEFKLHYQHANPQHEKYKEMVEVNGATIIGRDTEKQYLKDLLSQSNPDDLSILPIVG

LPGLGKTSLARLVFEDKEEGWDFDLRIWIHVDDNFDLEKFAVCIISEANKLMKGKFSHILNRSDCPSYLKFKDCI

EEILSSSSCLIVLDGLLYANEHWLPDLKYVLGETKHKCTRFIVTTSSEEVAQVMHTVPSYKLGGLSEDDCWTLFS

EKAFGSRDATIHSWQTKIGKAINQDMETWLAAGNDELWELVERHSLEREVFSSFKQIYYDMSLMLKSCFLYLSVF

PRGSDIDKDELIRQWIALDLINSSRHGTLPAFLHGEMFIEALVSRSFLQIVNTSLVTEKKCKNPPPTILKVHGLV

YDFLRYIAADDIFTLDYAKSPNISVRNQPFRYAVLTNYSWQAKMHEDFIAKAKAAKAAIFRNCEATMPIADIFPI

LRYSRLLDLSGCLFQELPTSIGELKHLRYLNVSFFRITELPNEMCCLRSLEYLDLSKTCIEVLPLFVGAFDKLKY

FNLHGCGKLKNLPQNIGDLKRLEHLSLSCCPEIRELPSSISGLDELKLLNLSSCTKLELLPHQFGNLSCLESLEM

AGCCSLQRLPESFGGLSKLCSLSLASCSSLQRLPDYIGELCSLEYLNISHAHLELPDSLTKLQSLHIVNS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
NB-ARC [Pfam fs]	105	181	1.8e-10
NB-ARC [Pfam ls]	105	401	4.3e-13
NB-ARC [Pfam fs]	338	401	4.1e-09
LRR [Pfam ls]	597	620	1
LRR [Pfam ls]	621	644	0.12
LRR [Pfam ls]	645	668	0.8
LRR [Pfam ls]	669	692	0.25
LRR [Pfam ls]	717	741	4.1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	528	550	0.39
LRR [sensitive, ls]	528	550	9.9
LRR [sensitive, ls]	551	573	0.56
LRR [sensitive, ls]	551	573	14
LRR [sensitive, ls]	574	595	0.21
LRR [sensitive, ls]	574	595	5.5
LRR [sensitive, ls]	597	620	0.039
LRR [sensitive, ls]	597	620	1
LRR [sensitive, ls]	621	644	0.0047
LRR [sensitive, ls]	621	644	0.12
LRR [sensitive, ls]	645	668	0.031
LRR [sensitive, ls]	645	668	0.8
LRR [sensitive, ls]	669	692	0.0099
LRR [sensitive, ls]	669	692	0.25
LRR [sensitive, ls]	693	716	1.2
LRR [sensitive, ls]	693	716	32
LRR [sensitive, ls]	717	741	0.16
LRR [sensitive, ls]	717	741	4.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
I2 [L. esculentum]	62	649	2e-34
Mla1 [Hordeum vulgare].	110	651	3e-28
RPS2 [A. thaliana]	115	723	5e-17
RPM1 [A. thaliana]	120	728	6e-25
N [N. glutinosa]	121	743	2e-15
Pib [Oryza sativa].	121	728	4e-22
Pi-ta [Oryza sativa]	121	588	2e-14
Xa1 [Oryza sativa]	121	466	8e-25
N [N. glutinosa]	511	743	6e-12
RPP5 [A. thaliana]	530	685	9e-12
RPP5 [A. thaliana]	532	744	3e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6149.m00367

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)