Report for 6190.m00124

 > 6190.m00124, length: 1010, copies: 1 

MARRAPLRCLFLSLVALFALLPFPPAAAAPCHPEDLLALRAFAGNLSAGGGGAGLRAAWSGDACCAWDGVACDAA

ARVTALRLPGRGLEGPIPPSLAALARLQDLDLSHNALTGGISALLAAVSLRTANLSSNLLNDTLLDLAALPHLSA

FNASNNSLSGALAPDLCAGAPALRVLDLSANLLAGTLSPSPSPPPCAATLQELYLASNSFHGALPPTLFGLAALQ

KLSLASNGLTGQVSSRLRGLTNLTSLDLSVNRFTGHLPDVFADLTSLQHLTAHSNGFSGLLPRSLSSLSSLRDLN

LRNNSFSGPIARVNFSSMPFLVSIDLATNHLNGSLPLSLADCGDLKSLSIAKNSLTGQLPEEYGRLGSLSVLSLS

NNTMRNISGALTVLRACKNLTTLILTKNFVGEDLPDDGIAGFDNLEVLALGDCALRGRVPEWLHQCKRLEVLDLS

WNQLVGTIPEWIGQLDNLTYLDLSNNSLVGEIPKSLTQLKSLVTARRSPGMAFTNMPLYVKHNKSTSGRQYNQLS

NFPPSLFLNDNGLNGTIWPEFGNLKELHVLDLSNNAISGSIPDVLSRMENLEVLDLSSNNLSGSIPSSLTDLTFL

SKFSVAHNHLVGPIPNGGQFFTFSNSSFEGNPGLCRSSSCDQNQPGETPTDNDIQRSGRNRKNKILGVAICIGLV

LVVLLAVILVNISKREVSIIDDEEINGSCHDSYDYWKPVLFFQDSAKELTVSDLIKSTNNFDQANIIGCGGFGLV

YKAYLPDGTKAAVKRLSGDCGQMEREFRAEVEALSQAQHKNLVSLRGYCRYGNDRLLIYSYMENNSLDYWLHERS

DGGYMLKWESRLKIAQGSARGLAYLHKDCEPNIIHRDVKSSNILLNENFEAHLADFGLARLIQPYDTHVTTDLVG

TLGYIPPEYSQSVIATPKGDVYSFGVVLLELLTGRRPMDVSKAKGSRDLVSYVLQMKSEKKEEQIFDTLIWSKTH

EKQLFSVLEAACRCISTDPRQRPSIEQVVAWLDSV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	101	121	1.2
LRR [Pfam ls]	199	222	2.6
LRR [Pfam ls]	223	246	3.3
LRR [Pfam ls]	247	270	0.0078
LRR [Pfam ls]	271	294	1.2
LRR [Pfam ls]	295	319	1.1
LRR [Pfam ls]	368	390	1.5
LRR [Pfam ls]	419	442	6.3
LRR [Pfam ls]	443	466	0.14
LRR [Pfam ls]	467	490	0.0013
LRR [Pfam ls]	551	574	0.011
LRR [Pfam fs]	575	598	3e-05
LRR [Pfam ls]	575	598	0.00049
Ser/Thr pkinase [Pfam fs]	736	1007	4.2e-50
Ser/Thr pkinase [Pfam ls]	736	1007	1.2e-50

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	101	121	0.057
LRR [sensitive, ls]	101	121	1.2
LRR [sensitive, ls]	124	146	1.3
LRR [sensitive, ls]	124	146	27
LRR [sensitive, ls]	147	171	0.4
LRR [sensitive, ls]	147	171	8.2
LRR [sensitive, ls]	172	195	0.35
LRR [sensitive, ls]	172	195	7.2
LRR [sensitive, ls]	199	222	0.13
LRR [sensitive, ls]	199	222	2.6
LRR [sensitive, ls]	223	246	0.16
LRR [sensitive, ls]	223	246	3.3
LRR [sensitive, ls]	247	270	0.00038
LRR [sensitive, ls]	247	270	0.0078
LRR [sensitive, ls]	271	294	0.056
LRR [sensitive, ls]	271	294	1.2
LRR [sensitive, ls]	295	319	0.055
LRR [sensitive, ls]	295	319	1.1
LRR [sensitive, ls]	320	343	1.9
LRR [sensitive, ls]	320	343	40
LRR [sensitive, ls]	344	367	0.88
LRR [sensitive, ls]	344	367	18
LRR [sensitive, ls]	368	390	0.075
LRR [sensitive, ls]	368	390	1.5
LRR [sensitive, ls]	394	418	0.4
LRR [sensitive, ls]	394	418	8.4
LRR [sensitive, ls]	419	442	0.3
LRR [sensitive, ls]	419	442	6.3
LRR [sensitive, ls]	443	466	0.0066
LRR [sensitive, ls]	443	466	0.14
LRR [sensitive, ls]	467	490	6.3e-05
LRR [sensitive, ls]	467	490	0.0013
LRR [sensitive, ls]	551	574	0.00054
LRR [sensitive, ls]	551	574	0.011
LRR [sensitive, ls]	575	598	2.4e-05
LRR [sensitive, ls]	575	598	0.00049

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	10	641	2e-52
FLS2 [A.thaliana]	10	630	1e-62
Xa21 [O. sativa]	10	826	7e-70
Cf-9 [L. pimpinellifolium]	63	685	1e-56
FLS2 [A.thaliana]	76	403	7e-29
FLS2 [A.thaliana]	81	1007	3e-93
Rpg1 [Hordeum vulgare]	667	1010	2e-29
Rpg1 [Hordeum vulgare]	722	1010	2e-33
Pto [L. esculentum]	726	1004	3e-51

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	665	687	out -> in

Report for 6190.m00124

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)