Report for 6247.m00042

 > 6247.m00042, length: 1044, copies: 1 

MALVVAVYVLTALAAATAAAPSPSSGDDSDATALLAFKAGLSDPLGVLRLNWTSGTPSCHWAGVSCGKRGHGRVT

ALALPNVPLHGGLSPSLGNLSFLSILNLTNASLTGEIPPELGRLSRLQYLNLNRNSLSGTIPGAMGNLTSLQQLD

LYHNHLSGQIPRELQNLGTLRYIRLDTNYLSGPIPDSVFNNTPLLSVLNLGNNSLSGKIPDSIASLSGLTLLVLQ

DNSLSGPLPPGIFNMSELQVIALAKTQNLTGTIPDNTSFHLPMLQVFSLSRNEFQGRIPSGLAACRFLRVLSLSY

NLFEDVIPAWLTRLPQLTLISLGGNSIAGTIPPALSNLTQLSQLDLVDSQLTGEIPVELGQLAQLTWLNLAANQL

TGSIPPSLGNLSLVLQLDLAQNRLNGTIPITFGNLGMLRYLNVEANNLEGDLHFLASLSNCRRLEYVDIAMNSYT

GRIPDSVGNLSSKLDSFVAHSNQITGGLPPTMANLSNLIAIYLYANQLTETIPTHMMQMKNLQMLNLHDNLMTGS

IPTEVGMLSSLVELYLGESLANVTYLTSLNLSFNKLEGQIPERGVFSNITLESLVGNRALCGLPRLGFSACASNS

RSGKLQILKYVLPSIVTFIIVASVFLYLMLKGKFKTRKELPAPSSVIGGINNHILVSYHEIVRATHNFSEGNLLG

IGNFGKVFKGQLSNGLIVAIKVLKVQSERATRSFDVECDALRMARHRNLVKILSTCSNLDFRALVLQYMPNGSLE

MLLHSEGRSFLGFRERLNIMLDVSMALEYLHHRHVDVVLHCDLKPSNVLLDEELTAHLADFGIAKLLLGDDTSVI

SASMPGTIGYMAPEYGLIGKASRMSDVFSYGILLLEVLTAKRPTDPMFDGELSLRQWVFDAFPARLVDVVDHKLL

QDEKTNGIGDIGTALDVSSNMLDRCIVSIVELGLLCSSDLPEKRVSIIEVVKKLHKVCGIHNPDSDEELSKAWEK

LRSRQSKISRMMLRLENNAWDKLRSRQSKISRRMLRLENNALGGEGFHMAYTYMVLWSYGKMSQIWIGV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	97	120	2.6
LRR [Pfam ls]	121	144	0.015
LRR [Pfam ls]	145	168	0.0028
LRR [Pfam ls]	169	193	6.2
LRR [Pfam ls]	194	217	0.75
LRR [Pfam ls]	218	241	6
LRR [Pfam ls]	292	315	0.2
LRR [Pfam ls]	316	339	0.026
LRR [Pfam ls]	340	363	8.2
LRR [Pfam ls]	364	387	0.014
LRR [Pfam ls]	511	534	3
Ser/Thr pkinase [Pfam fs]	668	870	4.5e-49
Ser/Thr pkinase [Pfam ls]	668	922	4.6e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	0.12
LRR [sensitive, ls]	97	120	2.6
LRR [sensitive, ls]	121	144	0.00072
LRR [sensitive, ls]	121	144	0.015
LRR [sensitive, ls]	145	168	0.00014
LRR [sensitive, ls]	145	168	0.0028
LRR [sensitive, ls]	169	193	0.3
LRR [sensitive, ls]	169	193	6.2
LRR [sensitive, ls]	194	217	0.036
LRR [sensitive, ls]	194	217	0.75
LRR [sensitive, ls]	218	241	0.29
LRR [sensitive, ls]	218	241	6
LRR [sensitive, ls]	242	267	1.7
LRR [sensitive, ls]	242	267	35
LRR [sensitive, ls]	268	291	0.51
LRR [sensitive, ls]	268	291	11
LRR [sensitive, ls]	292	315	0.0096
LRR [sensitive, ls]	292	315	0.2
LRR [sensitive, ls]	316	339	0.0012
LRR [sensitive, ls]	316	339	0.026
LRR [sensitive, ls]	340	363	0.39
LRR [sensitive, ls]	340	363	8.2
LRR [sensitive, ls]	364	387	0.0007
LRR [sensitive, ls]	364	387	0.014
LRR [sensitive, ls]	388	411	1.1
LRR [sensitive, ls]	388	411	24
LRR [sensitive, ls]	412	434	0.75
LRR [sensitive, ls]	412	434	16
LRR [sensitive, ls]	463	486	1.6
LRR [sensitive, ls]	463	486	34
LRR [sensitive, ls]	487	510	1.5
LRR [sensitive, ls]	487	510	30
LRR [sensitive, ls]	511	534	0.14
LRR [sensitive, ls]	511	534	3
LRR [sensitive, ls]	550	575	0.48
LRR [sensitive, ls]	550	575	10

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	756	1e-125
CLV2 [A. thaliana]	27	586	5e-57
FLS2 [A.thaliana]	28	589	6e-76
Cf-9 [L. pimpinellifolium]	50	568	2e-45
FLS2 [A.thaliana]	69	432	7e-51
Cf-9 [L. pimpinellifolium]	70	425	2e-31
Cf-9 [L. pimpinellifolium]	74	589	8e-54
FLS2 [A.thaliana]	76	962	1e-118
Cf-9 [L. pimpinellifolium]	340	605	1e-16
Pto [L. esculentum]	660	912	8e-30
Rpg1 [Hordeum vulgare]	665	972	3e-25
Rpg1 [Hordeum vulgare]	665	957	6e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	611	630	out -> in

Report for 6247.m00042

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)