Report for 6263.m00204

 > 6263.m00204, length: 661, copies: 1 

MESLSILDLSWNSLAGGLPAALGSLRMLEKADLSHNELAGRVPAEVGSLRELVFLDLSHNELAGPLPASMAGLGK

LQYLLLQENPIGTAVPAAVVGSLRRLQVVGMSGCGLTGPIPRGAFAALASLAALSLDRNRLDGPIPASLAALPRL

GRLNLSQNRLAGEIALPAEFVARLGRRLDVRGNDELCVGRGRYGGAQASYLGAPPCAAAGGGSGAAVGGTSSSPV

ESSAGAAATAGRGFRVYGIAGMFGGMFCFAANAPSLVDYSIPLAGVHQRSGEQVFLLQFCFAANAPSLVDYSIPL

AGVHQRSGEQVSGTSAFDVLHREKAAIRSNDAFMLVFICNVMIYLWNKLNHYMPIISTIQKPYHRHCDFTMAGFA

DALRPDKFTGVHFKRWQIRVTLSLTAMKCFWVSTGKPERVLTAEQQKQFEEATTLFVGCILSVLGDRLVEMYMHM

TDAKELWDALNTKFGATDASNNLYIMEQFHDYKMADNRSVVEQAHEIQTMAKELELLKCVLPDKFVAGCIIAKLP

PSWRSFGTALKHKRQEYSVEGLIASLDVEEKAREKDAASKGDGGQSSANVVHKAQNKSKGKYKAQQTTNFKKQKK

NNNNPNQDERTCFVCGQVGHLARKCPQRKGMKAPAGQTSKSANVTIGNTGDGSGSHGVPPS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	3	26	0.59
LRR [Pfam ls]	51	74	2.9
LRR [Pfam ls]	75	99	6.8
LRR [Pfam ls]	100	124	3.7
LRR [Pfam ls]	125	148	6.6

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	3	26	0.019
LRR [sensitive, ls]	3	26	0.59
LRR [sensitive, ls]	27	50	1.6
LRR [sensitive, ls]	27	50	50
LRR [sensitive, ls]	51	74	0.091
LRR [sensitive, ls]	51	74	2.9
LRR [sensitive, ls]	75	99	0.22
LRR [sensitive, ls]	75	99	6.8
LRR [sensitive, ls]	100	124	0.12
LRR [sensitive, ls]	100	124	3.7
LRR [sensitive, ls]	125	148	0.21
LRR [sensitive, ls]	125	148	6.6
LRR [sensitive, ls]	149	175	0.63
LRR [sensitive, ls]	149	175	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	161	4e-17
CLV2 [A. thaliana]	1	174	2e-13
CLV2 [A. thaliana]	1	164	1e-11
FLS2 [A.thaliana]	1	174	7e-19
FLS2 [A.thaliana]	1	189	9e-19
FLS2 [A.thaliana]	1	164	5e-17
FLS2 [A.thaliana]	1	169	2e-16
FLS2 [A.thaliana]	1	164	2e-16
FLS2 [A.thaliana]	1	164	5e-13
FLS2 [A.thaliana]	1	164	8e-12
Xa21 [O. sativa]	1	164	8e-18
Xa21 [O. sativa]	1	195	1e-14
Xa21 [O. sativa]	1	189	1e-14
CLV2 [A. thaliana]	2	166	5e-12
CLV2 [A. thaliana]	3	166	6e-22
FLS2 [A.thaliana]	3	174	9e-19
FLS2 [A.thaliana]	3	170	1e-13
Xa21 [O. sativa]	3	163	7e-15
Xa21 [O. sativa]	3	184	1e-13
Xa21 [O. sativa]	3	164	1e-10
Cf-9 [L. pimpinellifolium]	4	183	3e-13
CLV2 [A. thaliana]	4	164	2e-17
FLS2 [A.thaliana]	4	169	9e-16
Xa21 [O. sativa]	4	164	3e-16
CLV2 [A. thaliana]	7	162	8e-14
FLS2 [A.thaliana]	7	187	5e-13
Xa21 [O. sativa]	7	164	1e-14
Xa21 [O. sativa]	30	167	4e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value
Zinc knuckle	610	627	1.4e-07

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6263.m00204

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)