Report for 6324.m00133

 > 6324.m00133, length: 751, copies: 1 

MGVGPHCTTSLLIILAVVITSSLLTTTIKADEPSNDTDIAALLAFKAQFSDPLGFLRDGWREDNASCFCQWIGVS

CSRRRQRVTALELPGIPLQGSITPHLGNLSFLYVLNLANTSLTGTLPGVIGRLHRLELLDLGYNALSGNIPATIG

NLTKLELLNLEFNQLSGPIPAELQGLRSLGSMNLRRNYLSGLIPNSLFNNTPLLGYLSIGNNSLSGPIPHVIFSL

HVLQVLVLEHNQLSGSLPPAIFNMSRLEKLYATRNNLTGPIPYPAENQTLMNIPMIRVMCLSFNGFIGRIPPGLA

ACRKLQMLELGGNLLTDHVPEWLAGLSLLSTLVIGQNELVGSIPVVLSNLTKLTVLDLSSCKLSGIIPLELGKMT

QLNILHLSFNRLTGPFPTSLGGIPKYFSNLTYLTSLNLSFNNLQGQIPSGGIFSNITMQSLMGNAGLCGAPRLGF

PACLEKSDSTRTKHLLKIVLPTVIVAFGAIVVFLYLMIAKKMKNPDITASFGIADAICHRLVSYQEIVRATENFN

EDNLLGVGSFGKVFKGRLDDGLVVAIKILNMQVERAIRSFDAECHVLRMARHRNLIKILNTCSNLDFRALFLQFM

PNGNLESYLHSESRPCVGSFLKRMEIMLDVSMAMEYLHHEHHEVVLHCDLKPSNVLFDEEMTAHVADFGIAKMLL

GDDNSAVSASMLGTIGYMAPVFELGLLCSADSPEQRTAMSDVVVTLKKIRKDYVKLMATTRPGKKLMATTVSVVQ

Q

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	106	129	4.9
LRR [Pfam ls]	130	153	0.036
LRR [Pfam ls]	154	177	0.064
LRR [Pfam ls]	178	201	4.3
LRR [Pfam ls]	227	250	0.17
LRR [Pfam ls]	304	327	0.071
LRR [Pfam ls]	352	375	0.0073
LRR [Pfam ls]	376	406	0.048
LRR [Pfam ls]	407	431	1.9
Ser/Thr pkinase [Pfam fs]	524	695	4.7e-39
Ser/Thr pkinase [Pfam ls]	524	749	8.5e-20

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	82	105	4.6
LRR [sensitive, ls]	82	105	51
LRR [sensitive, ls]	106	129	0.45
LRR [sensitive, ls]	106	129	4.9
LRR [sensitive, ls]	130	153	0.0033
LRR [sensitive, ls]	130	153	0.036
LRR [sensitive, ls]	154	177	0.0059
LRR [sensitive, ls]	154	177	0.064
LRR [sensitive, ls]	178	201	0.39
LRR [sensitive, ls]	178	201	4.3
LRR [sensitive, ls]	203	226	0.53
LRR [sensitive, ls]	203	226	5.8
LRR [sensitive, ls]	227	250	0.015
LRR [sensitive, ls]	227	250	0.17
LRR [sensitive, ls]	251	274	1.4
LRR [sensitive, ls]	251	274	16
LRR [sensitive, ls]	280	303	3.8
LRR [sensitive, ls]	280	303	41
LRR [sensitive, ls]	304	327	0.0064
LRR [sensitive, ls]	304	327	0.071
LRR [sensitive, ls]	328	351	0.84
LRR [sensitive, ls]	328	351	9.2
LRR [sensitive, ls]	352	375	0.00067
LRR [sensitive, ls]	352	375	0.0073
LRR [sensitive, ls]	376	406	0.0043
LRR [sensitive, ls]	376	406	0.048
LRR [sensitive, ls]	407	431	0.18
LRR [sensitive, ls]	407	431	1.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	10	424	1e-58
FLS2 [A.thaliana]	17	439	2e-47
CLV2 [A. thaliana]	38	439	1e-36
Cf-9 [L. pimpinellifolium]	64	423	9e-28
CLV2 [A. thaliana]	74	422	3e-25
FLS2 [A.thaliana]	80	697	5e-94
Xa21 [O. sativa]	81	613	9e-78
Cf-9 [L. pimpinellifolium]	83	423	2e-31
Cf-9 [L. pimpinellifolium]	83	439	4e-29
FLS2 [A.thaliana]	90	423	1e-46
Cf-9 [L. pimpinellifolium]	107	446	1e-30
Cf-9 [L. pimpinellifolium]	181	458	6e-11
Rpg1 [Hordeum vulgare]	488	697	2e-18
Pto [L. esculentum]	515	697	2e-23
Rpg1 [Hordeum vulgare]	521	697	1e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	468	489	out -> in

Report for 6324.m00133

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)