Report for 6324.m00134

 > 6324.m00134, length: 880, copies: 1 

MALVRLPVWIFVAALLIASSSTVPCASSPGPIASKSNGSETDLAALLAFKAQLSDSNNILAGNWTTGTPFCRWIP

LGLTACPYLQVIAMPYNLFEGVLPPWLGRLTNLDAISLGGNNFDAGPIPTKLSNLTMLTVLDLTTCNLTGNIPTD

IGHLGQLSWLHLAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLLSTVDSMNSLTAVDVTKNNLHGDLNFLSTV

SNCRKLSTLQMDLNYITGILPDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMT

IENLQWLDLSGNSLSGFIPSSTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDK

IVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSTGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQT

LDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEGGVFANITLQYLVGNSGLCGAARLGFPPCQTTSPNRN

NGHMLKYLLPTIIIVVGVVACCLYVMIRKKANHQNTSAGKPDLISHQLLSYHELRATDDFSDDNMLGFGSFGKVF

RGQLSNGMVVAIKVIHQHLEHAMRSFDTKCHVLRMARHRNLIKILNTCSNLDFKALVLQYMPKGSLEALLHSEQG

KQLGFLERLDIMLDVSMAMEYLHHEHYEVVLHCDLKPSNVLFDDDMTAHVADFGIARLLLGDDNSMISASMPGTV

GYMAPEYGTLGKASRKSDVFSYGIMLLEVFTAKRPTDAMFVGELNIRQWVQQAFPAELVHVVDCQLLQNGSSSSS

SNMHGFLVPVFELGLLCSAHSPEQRMAMSDVVVTLKKIRKDYVKLMATTVSVVQQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	132	155	2.5
LRR [Pfam ls]	156	179	5.2
LRR [Pfam ls]	255	278	0.061
LRR [Pfam ls]	279	302	2.7
LRR [Pfam ls]	303	326	0.0017
LRR [Pfam ls]	327	350	0.27
LRR [Pfam ls]	351	374	0.0072
LRR [Pfam ls]	375	398	0.83
LRR [Pfam ls]	423	446	0.49
LRR [Pfam ls]	447	470	0.0025
LRR [Pfam ls]	471	493	2.9
Ser/Thr pkinase [Pfam fs]	585	787	2e-43
Ser/Thr pkinase [Pfam ls]	585	832	2.2e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	83	106	4.8
LRR [sensitive, ls]	83	106	52
LRR [sensitive, ls]	107	131	1.1
LRR [sensitive, ls]	107	131	12
LRR [sensitive, ls]	132	155	0.23
LRR [sensitive, ls]	132	155	2.5
LRR [sensitive, ls]	156	179	0.47
LRR [sensitive, ls]	156	179	5.2
LRR [sensitive, ls]	204	226	6.6
LRR [sensitive, ls]	204	226	72
LRR [sensitive, ls]	230	253	0.62
LRR [sensitive, ls]	230	253	6.8
LRR [sensitive, ls]	255	278	0.0056
LRR [sensitive, ls]	255	278	0.061
LRR [sensitive, ls]	279	302	0.24
LRR [sensitive, ls]	279	302	2.7
LRR [sensitive, ls]	303	326	0.00015
LRR [sensitive, ls]	303	326	0.0017
LRR [sensitive, ls]	327	350	0.025
LRR [sensitive, ls]	327	350	0.27
LRR [sensitive, ls]	351	374	0.00065
LRR [sensitive, ls]	351	374	0.0072
LRR [sensitive, ls]	375	398	0.076
LRR [sensitive, ls]	375	398	0.83
LRR [sensitive, ls]	399	422	0.67
LRR [sensitive, ls]	399	422	7.4
LRR [sensitive, ls]	423	446	0.045
LRR [sensitive, ls]	423	446	0.49
LRR [sensitive, ls]	447	470	0.00023
LRR [sensitive, ls]	447	470	0.0025
LRR [sensitive, ls]	471	493	0.26
LRR [sensitive, ls]	471	493	2.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	3	487	7e-60
FLS2 [A.thaliana]	32	496	4e-58
CLV2 [A. thaliana]	42	500	2e-42
FLS2 [A.thaliana]	43	193	2e-11
FLS2 [A.thaliana]	59	529	4e-58
Cf-9 [L. pimpinellifolium]	60	296	2e-17
CLV2 [A. thaliana]	60	507	2e-38
Cf-9 [L. pimpinellifolium]	74	488	2e-43
Xa21 [O. sativa]	74	677	3e-96
FLS2 [A.thaliana]	75	864	1e-122
Cf-9 [L. pimpinellifolium]	83	490	2e-42
Cf-9 [L. pimpinellifolium]	102	500	6e-38
Cf-9 [L. pimpinellifolium]	108	508	3e-44
CLV2 [A. thaliana]	158	508	9e-32
Cf-9 [L. pimpinellifolium]	200	488	1e-21
Xa21 [O. sativa]	234	514	3e-29
Cf-9 [L. pimpinellifolium]	272	514	2e-15
Xa21 [O. sativa]	307	508	3e-27
Xa21 [O. sativa]	328	495	7e-25
Pto [L. esculentum]	581	861	8e-30
Rpg1 [Hordeum vulgare]	582	783	3e-25
Rpg1 [Hordeum vulgare]	582	783	3e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	533	552	out -> in

Report for 6324.m00134

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)