Report for 6324.m00137

 > 6324.m00137, length: 1184, copies: 1 

MPINGGVTNRPCRRGHQSAATEAGRRLSFPLTDLDQVREEELEEVVDGKEAKTPKAKAKSATHEIDSIALVDRKL

DAIPTWRANCRNMNSAIIKGGNARDLKVDGCGDKGFRQVQALSMRVPNMAWLLLPPFNSIRLLMLVLPLTIPYAS

GSIPRDGGSSSNGTGDDLSALLAFKARLSDPLGVLAGNWTTKVSMCRWVGVSCSRRRPRVVGLKLWDVPLQGELT

PHLGNLSFLRVLNLGGINLTGPIPADLGRLHRLRILRLAHNTMSDTIPSALGNLTKLEILNLYGNHISGHIPAEL

QNLHSLRQMVLTSNYLSDNQLSGPVPPAIFNMSSLEAILIWKNNLTGPIPTNRSFNLPMLQDIELDTNKFTGLIP

SGLASCQNLETISLSENLFSGVVPPWLAKMSRLTLLFLDGNELVGTIPSLLGNLPMLSELDLSDSNLSGHIPVEL

GTLTKLTYLDLSFNQLNGAFPAFVGNFSELTFLGLGYNQLTGPVPSTFGNIRPLVEIKIGGNHLQGDLSFLSSLC

NCRQLQYLLISHNSFTGSLPNYVGNLSTELLGFEGDDNHLTGGLPATLSNLTNLRALNLSYNQLSDSIPASLMKL

ENLQGLDLTSNGISGPITEEIGTARFVWLYLTDNKLSGSIPDSIGNLTMLQYISLSDNKLSSTIPTSLFYLGIVQ

LFLSNNNLNGTLPSDLSHIQDMFALDTSDNLLVGQLPNSFGYHQMLAYLNLSHNSFTDSIPNSISHLTSLEVLDL

SYNNLSGTIPKYLANFTYLTTLNLSSNNLKGEIPNGGVFSNITLISLMGNAALCGLPRLGFLPCLDKSHSTNGSH

YLKFILPAITIAVGALALCLYQMTRKKIKRKLDTTTPTSYRLVSYQEIVRATESFNEDNMLGAGSFGKVYKGHLD

DGMVVAVKVLNMQVEQAMRSFDVECQVLRMVQHRNLIRILNICSNTDFRALLLQYMPNGSLETYLHKQGHPPLGF

LKRLDIMLDVSMAMEHLHYHHSEVVLHCDLKPSNVLFDEEITAHVADFGIAKLLLGDDNSAVSASMPGTIGYMAP

EYAFMGKASRKSDVFSYGIMLLEVFTGKRPTDAMFVGDMSLRKWVSEAFPARLADIVDGRLLQAETLIEQGVRQN

NATSLPRSATWPNEGLLLPIFELGLMCCSSSPAERMGISDVVVKLKSIRKDYFSFTGAI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	257	280	0.042
LRR [Pfam fs]	281	304	3.4e-05
LRR [Pfam ls]	281	304	0.00057
LRR [Pfam ls]	383	406	0.33
LRR [Pfam ls]	407	430	0.021
LRR [Pfam ls]	431	454	0.33
LRR [Pfam ls]	455	478	0.32
LRR [Pfam ls]	479	502	0.86
LRR [Pfam ls]	529	552	0.097
LRR [Pfam ls]	578	601	0.0082
LRR [Pfam ls]	625	648	0.14
LRR [Pfam ls]	672	695	0.72
LRR [Pfam ls]	720	743	0.029
LRR [Pfam fs]	744	767	3.2e-05
LRR [Pfam ls]	744	767	0.00054
LRR [Pfam ls]	768	790	0.27
Ser/Thr pkinase [Pfam fs]	880	1082	1.3e-52
Ser/Thr pkinase [Pfam ls]	880	1167	3.8e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	233	256	0.54
LRR [sensitive, ls]	233	256	5.9
LRR [sensitive, ls]	257	280	0.0039
LRR [sensitive, ls]	257	280	0.042
LRR [sensitive, ls]	281	304	5.2e-05
LRR [sensitive, ls]	281	304	0.00057
LRR [sensitive, ls]	305	333	4.4
LRR [sensitive, ls]	305	333	48
LRR [sensitive, ls]	359	382	1.3
LRR [sensitive, ls]	359	382	14
LRR [sensitive, ls]	383	406	0.03
LRR [sensitive, ls]	383	406	0.33
LRR [sensitive, ls]	407	430	0.002
LRR [sensitive, ls]	407	430	0.021
LRR [sensitive, ls]	431	454	0.03
LRR [sensitive, ls]	431	454	0.33
LRR [sensitive, ls]	455	478	0.029
LRR [sensitive, ls]	455	478	0.32
LRR [sensitive, ls]	479	502	0.079
LRR [sensitive, ls]	479	502	0.86
LRR [sensitive, ls]	503	525	5.1
LRR [sensitive, ls]	503	525	56
LRR [sensitive, ls]	529	552	0.0089
LRR [sensitive, ls]	529	552	0.097
LRR [sensitive, ls]	578	601	0.00075
LRR [sensitive, ls]	578	601	0.0082
LRR [sensitive, ls]	602	622	2.7
LRR [sensitive, ls]	602	622	29
LRR [sensitive, ls]	625	648	0.012
LRR [sensitive, ls]	625	648	0.14
LRR [sensitive, ls]	649	669	0.78
LRR [sensitive, ls]	649	669	8.5
LRR [sensitive, ls]	672	695	0.066
LRR [sensitive, ls]	672	695	0.72
LRR [sensitive, ls]	720	743	0.0027
LRR [sensitive, ls]	720	743	0.029
LRR [sensitive, ls]	744	767	5e-05
LRR [sensitive, ls]	744	767	0.00054
LRR [sensitive, ls]	768	790	0.025
LRR [sensitive, ls]	768	790	0.27
LRR [sensitive, ls]	791	813	1.9
LRR [sensitive, ls]	791	813	21

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	134	968	1e-122
CLV2 [A. thaliana]	167	804	7e-66
FLS2 [A.thaliana]	167	784	2e-87
Cf-9 [L. pimpinellifolium]	188	823	7e-50
Cf-9 [L. pimpinellifolium]	212	807	1e-60
FLS2 [A.thaliana]	220	1180	1e-149
FLS2 [A.thaliana]	363	808	4e-61
CLV2 [A. thaliana]	376	807	3e-42
Cf-9 [L. pimpinellifolium]	571	824	1e-21
Pto [L. esculentum]	864	1171	7e-34
Rpg1 [Hordeum vulgare]	866	1078	3e-24
Rpg1 [Hordeum vulgare]	877	1078	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	829	846	out -> in

Report for 6324.m00137

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)