Report for 6324.m00146

 > 6324.m00146, length: 842, copies: 1 

MAPGSPVCISVSALLLITLSPAVAAAAASPPGRSKSNGSDTDLAALLAFKGELSDPYSLLATNWTAGTPFCRWMG

ITCSRRQQQRVTGVELPGVPLQGKLSPHIGNLSFLSVLNLTITNLTGSIPDDIGRLHRLELLDLGNNAFSGVIPA

SIGNLTRLGVLRLAVNRLTGPVPPGVFNMSMLGVIALALNGLTGPIPGNESFRLPSLWFFSVDANNFTGPIPQGF

AACQQLQVFSLIQNLFEGALPSWLGKLTNLVKLNLGENHFDGGSIPDALSNITMLASLELSTCNLTGTIPADIGK

LGKLSDLLIARNQLRGPIPASLGNLSALSRLDLSTNLLDGSVPATVGSMNSLTYFVIFENSLQGDLKFLSALSNC

RKLSVLEIDSNYFTGNLPDYVGNLSSTLQAFIARRNNISGVLPSTVWNLTSLKYLDLSDNQLHSTISESIMDLEI

LQWLDLSENSLFGPIPSNIGVLKNIQRLFLGTNQFSSSISMGISNMTKLEYLDLSDNQLASTVPPSLFHLDRLVK

LDLSHNFLSGALPADIGYLKQMNIMDLSSNHFTGILPDSIELQMIAYLNLSVNLFQNSIPDSFRVLTSLETLDLS

HNNISGTIPEYLANFTVLSSLNLSFNNLHGQIPETGVFSNITLESLVGNSGLCGAVRLGFSPCQTTSPKKNHRII

KYLVPPIIITVGAVACCLYVILKYKVKHQKMSVGMVDMARHQLLSYHELARATNDFSDDNMLGSGSFGKVFKGQL

SSGLVVAIKVIHQHMEHAIRSFDTECRVLRTARHRNLIKILNTCSNQDFRALVLEYMPNGSLEALLHSYQRIQLS

FLERLDITPSVPQYKGF

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	133	156	0.0067
LRR [Pfam ls]	254	278	0.42
LRR [Pfam ls]	279	302	2.9
LRR [Pfam ls]	303	326	4.3
LRR [Pfam ls]	377	400	5.1
LRR [Pfam ls]	426	449	0.073
LRR [Pfam ls]	450	473	4.1
LRR [Pfam ls]	498	521	0.02
LRR [Pfam ls]	522	545	0.031
LRR [Pfam ls]	569	592	5.5
LRR [Pfam fs]	593	616	7.9e-06
LRR [Pfam ls]	593	616	0.00012
LRR [Pfam ls]	617	639	4.2
Ser/Thr pkinase [Pfam fs]	731	818	2.9e-19

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	109	132	0.53
LRR [sensitive, ls]	109	132	5.9
LRR [sensitive, ls]	133	156	0.00061
LRR [sensitive, ls]	133	156	0.0067
LRR [sensitive, ls]	157	180	4
LRR [sensitive, ls]	157	180	44
LRR [sensitive, ls]	206	229	7.1
LRR [sensitive, ls]	206	229	77
LRR [sensitive, ls]	230	253	1.8
LRR [sensitive, ls]	230	253	20
LRR [sensitive, ls]	254	278	0.039
LRR [sensitive, ls]	254	278	0.42
LRR [sensitive, ls]	279	302	0.27
LRR [sensitive, ls]	279	302	2.9
LRR [sensitive, ls]	303	326	0.39
LRR [sensitive, ls]	303	326	4.3
LRR [sensitive, ls]	327	350	1.9
LRR [sensitive, ls]	327	350	21
LRR [sensitive, ls]	351	373	3.9
LRR [sensitive, ls]	351	373	42
LRR [sensitive, ls]	377	400	0.47
LRR [sensitive, ls]	377	400	5.1
LRR [sensitive, ls]	402	425	2.2
LRR [sensitive, ls]	402	425	24
LRR [sensitive, ls]	426	449	0.0066
LRR [sensitive, ls]	426	449	0.073
LRR [sensitive, ls]	450	473	0.37
LRR [sensitive, ls]	450	473	4.1
LRR [sensitive, ls]	474	497	1.3
LRR [sensitive, ls]	474	497	14
LRR [sensitive, ls]	498	521	0.0018
LRR [sensitive, ls]	498	521	0.02
LRR [sensitive, ls]	522	545	0.0028
LRR [sensitive, ls]	522	545	0.031
LRR [sensitive, ls]	546	568	1.3
LRR [sensitive, ls]	546	568	14
LRR [sensitive, ls]	569	592	0.5
LRR [sensitive, ls]	569	592	5.5
LRR [sensitive, ls]	593	616	1.1e-05
LRR [sensitive, ls]	593	616	0.00012
LRR [sensitive, ls]	617	639	0.38
LRR [sensitive, ls]	617	639	4.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	817	1e-128
CLV2 [A. thaliana]	16	653	2e-56
FLS2 [A.thaliana]	40	633	1e-82
Cf-9 [L. pimpinellifolium]	63	654	9e-58
FLS2 [A.thaliana]	84	336	1e-15
FLS2 [A.thaliana]	86	832	1e-112
Cf-9 [L. pimpinellifolium]	212	661	2e-38
CLV2 [A. thaliana]	282	657	4e-34
Pto [L. esculentum]	723	832	1e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	678	697	out -> in

Report for 6324.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)