Report for 6342.m00175

 > 6342.m00175, length: 607, copies: 1 

MQLCKILGEEEAVQTGVNLVDNGGPRGDGGLGVRVEEDILGSGRGGLRFRQDLWTSAEAAALGAAAGYTGVNILD

LLCVMKPLKLWIHLAKESELNQQQDNPEHHLLHAMRRHILVCHLPLIILLSSSLSSSCRSDHQIQIQALVQFKAS

LIDPLDNLQSWTTNATTSPCSYLGVQCDPVTGTVTEISLASMNLSGRISPAIGALAALTRLDLGDNTISGGVPPE

LSNCTQLQFLNLSCNGLTGELPNLSAKLAALDTLDVANNYLSGRFPAWVGNLSGLVILAVGENSYDRGETPPSIG

NLKKLTHLYLSSCYLTGEIPESIFGLTALRTLDMSKNYLTGGIPAAIGNLCELWSIQLYSNNLTGELPPELGKLT

GLRELDVSGNKLSGEIPASLAVLRNFEVIHLQWNNLSGPIPAAWGELRFLKRFAVYENNFSGEFPANFGRFSPLY

GIDISENAFSGPFPRYLCHGKNLQYLLTIGNSFSGELPEEYSACHHLVIFRVHGNTLTGNLPAWVWGQQSAEIID

VSNNGFTGRISPAISKAQRLKELWLHNNRLDGEIPREIGRLWRLKKLYLSNNSFSGVIPPEIGNLSKLTELTLGG

NMLTGWL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	207	230	0.028
LRR [Pfam ls]	231	254	0.15
LRR [Pfam ls]	304	327	0.006
LRR [Pfam ls]	328	351	0.13
LRR [Pfam ls]	352	375	0.093
LRR [Pfam ls]	376	399	0.0038
LRR [Pfam ls]	400	423	1.6
LRR [Pfam ls]	544	567	0.88
LRR [Pfam ls]	568	591	0.0033

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	183	206	3.6
LRR [sensitive, ls]	183	206	40
LRR [sensitive, ls]	207	230	0.0026
LRR [sensitive, ls]	207	230	0.028
LRR [sensitive, ls]	231	254	0.014
LRR [sensitive, ls]	231	254	0.15
LRR [sensitive, ls]	255	278	0.52
LRR [sensitive, ls]	255	278	5.7
LRR [sensitive, ls]	304	327	0.00055
LRR [sensitive, ls]	304	327	0.006
LRR [sensitive, ls]	328	351	0.012
LRR [sensitive, ls]	328	351	0.13
LRR [sensitive, ls]	352	375	0.0085
LRR [sensitive, ls]	352	375	0.093
LRR [sensitive, ls]	376	399	0.00035
LRR [sensitive, ls]	376	399	0.0038
LRR [sensitive, ls]	400	423	0.15
LRR [sensitive, ls]	400	423	1.6
LRR [sensitive, ls]	424	447	3.9
LRR [sensitive, ls]	424	447	43
LRR [sensitive, ls]	496	519	6.8
LRR [sensitive, ls]	496	519	74
LRR [sensitive, ls]	520	543	1.1
LRR [sensitive, ls]	520	543	12
LRR [sensitive, ls]	544	567	0.08
LRR [sensitive, ls]	544	567	0.88
LRR [sensitive, ls]	568	591	0.0003
LRR [sensitive, ls]	568	591	0.0033

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	114	605	6e-61
Cf-9 [L. pimpinellifolium]	123	605	2e-42
FLS2 [A.thaliana]	139	605	1e-55
FLS2 [A.thaliana]	140	607	1e-62
CLV2 [A. thaliana]	143	607	4e-45
FLS2 [A.thaliana]	156	560	5e-37
CLV2 [A. thaliana]	172	605	4e-53
Xa21 [O. sativa]	182	601	1e-49
Xa21 [O. sativa]	182	512	7e-36
Cf-9 [L. pimpinellifolium]	183	416	1e-22
Cf-9 [L. pimpinellifolium]	183	489	4e-20
FLS2 [A.thaliana]	183	385	8e-22
FLS2 [A.thaliana]	184	601	4e-55
Cf-9 [L. pimpinellifolium]	186	596	6e-32
Xa21 [O. sativa]	186	458	1e-38
Xa21 [O. sativa]	186	355	3e-11
Cf-9 [L. pimpinellifolium]	187	605	2e-36
Cf-9 [L. pimpinellifolium]	187	584	9e-34
CLV2 [A. thaliana]	187	424	2e-18
Xa21 [O. sativa]	268	607	2e-42

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6342.m00175

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)