Report for 6441.m00135

 > 6441.m00135, length: 313, copies: 1 

MLRRWPETPRRWLKSGDRRRPRSQPGGVVKRPRDHSVLSEQTTDFNHLNVKILPVPVHTRQLAEQVNKIIQRQKL

KVKEWHGLLLWEGITCNEDGAVIEVHLASKGLEGQISPSLGELTSLSRLNLSYNSLSGSLPAELMSSGSIVVLDV

SFNRLNGDLQELNPSVSNQPLKVLNISSNRFTGEFPSITWEKMRNLVAINASNNSFTGHIPSSFCSSSTSFAVLD

LGYNQFSGNIPPGIGKCSALRLLKANANNIRGPLPGDLFNATSLEYLSFANNGLQGTIDDALIVKLINLVFVDLR

WNRFSGKIPNSIG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	1.1
LRR [Pfam ls]	195	219	1.5
LRR [Pfam ls]	220	243	5
LRR [Pfam ls]	268	292	3.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	120	143	0.051
LRR [sensitive, ls]	120	143	1.1
LRR [sensitive, ls]	144	166	1.4
LRR [sensitive, ls]	144	166	29
LRR [sensitive, ls]	170	194	0.66
LRR [sensitive, ls]	170	194	14
LRR [sensitive, ls]	195	219	0.073
LRR [sensitive, ls]	195	219	1.5
LRR [sensitive, ls]	220	243	0.24
LRR [sensitive, ls]	220	243	5
LRR [sensitive, ls]	244	267	2.2
LRR [sensitive, ls]	244	267	45
LRR [sensitive, ls]	268	292	0.18
LRR [sensitive, ls]	268	292	3.7
LRR [sensitive, ls]	293	313	2.5
LRR [sensitive, ls]	293	313	52

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	80	312	3e-19
Cf-9 [L. pimpinellifolium]	86	312	1e-11
FLS2 [A.thaliana]	86	313	4e-23
Xa21 [O. sativa]	86	313	2e-22
Cf-9 [L. pimpinellifolium]	92	312	1e-16
Xa21 [O. sativa]	92	313	5e-21
FLS2 [A.thaliana]	96	312	8e-20
Cf-9 [L. pimpinellifolium]	97	308	1e-15
CLV2 [A. thaliana]	97	309	3e-19
CLV2 [A. thaliana]	97	312	4e-16
FLS2 [A.thaliana]	99	313	3e-18
Xa21 [O. sativa]	99	312	5e-12
Cf-9 [L. pimpinellifolium]	100	313	3e-12
CLV2 [A. thaliana]	100	310	2e-22
CLV2 [A. thaliana]	100	312	6e-18
FLS2 [A.thaliana]	100	313	4e-19
FLS2 [A.thaliana]	100	312	2e-18
Cf-9 [L. pimpinellifolium]	102	311	4e-17
FLS2 [A.thaliana]	102	293	1e-19
FLS2 [A.thaliana]	102	309	3e-19
Xa21 [O. sativa]	102	313	2e-12
Xa21 [O. sativa]	107	312	3e-16
Xa21 [O. sativa]	109	285	1e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6441.m00135

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)