Report for 6441.m00137

 > 6441.m00137, length: 670, copies: 1 

MEGREARRSMATTLEEVLLSIETTSSAHSLSSSTTASKEALELGRVISSLAVPRSLEAKLMVKTLASERRKRKVN

NLERKGNKVDVSIAANDYYKPRAVKSHNSCTEEDRSSLLRFLAGLSHDGGLAASWRPDVDCCHAWEGVVCDDEGT

VTEVSLQSRGLHGSISLSSLAGLTSLTRLNLSHNALSGSLPPELMYSASLVVLDVSFNSLDGVLPPLPMLMTGLK

HPLQLQVLNISTNNLHGEIPESIGQLKKLEVIRLSNNNMSGNLPSSLGNCTRLTTIDLKMNSFSGDLGSVDFSSL

HNLRALDLLHNDFSGVIPESIYSCNNLTALRLSSNQIHGEISSKIGDLKYLSFLSITENSFSDIAKTLHAFKSSR

NLTTLFIGENFWGEVIPQDETIESLESIRHLSIYRCSLIGNIPLWLSKLKNLEVLDLSNNQLTGPMPSWLNSFNN

LFYLDVSNNSLTGQIPATLIEIPMLKSDDYKAHRTILFDLPVYVTTLSRQYRAVTSFPALLNLSANSFTSVIPPK

IGELKALTHLDFSSNQLQGEIPPSICNLTNLQVLDLSRNYLTGPIPEALNKLNFLSKFNISDNDLEGPIPTGGQM

NTFSSSSFAGNPKLCGSMLAPCGSVEVAHTIPTISEDQQCSSKTISAIAFGVFFGIGVLYDQLVLSRYYG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	175	198	0.09
LRR [Pfam ls]	199	222	6.6
LRR [Pfam ls]	229	252	0.11
LRR [Pfam ls]	253	276	0.06
LRR [Pfam ls]	302	325	6.3
LRR [Pfam ls]	326	349	0.63
LRR [Pfam ls]	402	425	4.4
LRR [Pfam ls]	426	449	0.0016
LRR [Pfam ls]	450	473	1.9
LRR [Pfam ls]	531	554	0.006
LRR [Pfam fs]	555	578	3e-05
LRR [Pfam ls]	555	578	0.00048

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	150	174	4.2
LRR [sensitive, ls]	150	174	87
LRR [sensitive, ls]	175	198	0.0043
LRR [sensitive, ls]	175	198	0.09
LRR [sensitive, ls]	199	222	0.32
LRR [sensitive, ls]	199	222	6.6
LRR [sensitive, ls]	229	252	0.0055
LRR [sensitive, ls]	229	252	0.11
LRR [sensitive, ls]	253	276	0.0029
LRR [sensitive, ls]	253	276	0.06
LRR [sensitive, ls]	277	301	1.4
LRR [sensitive, ls]	277	301	29
LRR [sensitive, ls]	302	325	0.3
LRR [sensitive, ls]	302	325	6.3
LRR [sensitive, ls]	326	349	0.03
LRR [sensitive, ls]	326	349	0.63
LRR [sensitive, ls]	350	372	1.4
LRR [sensitive, ls]	350	372	29
LRR [sensitive, ls]	402	425	0.21
LRR [sensitive, ls]	402	425	4.4
LRR [sensitive, ls]	426	449	7.5e-05
LRR [sensitive, ls]	426	449	0.0016
LRR [sensitive, ls]	450	473	0.09
LRR [sensitive, ls]	450	473	1.9
LRR [sensitive, ls]	507	530	1.9
LRR [sensitive, ls]	507	530	39
LRR [sensitive, ls]	531	554	0.00029
LRR [sensitive, ls]	531	554	0.006
LRR [sensitive, ls]	555	578	2.3e-05
LRR [sensitive, ls]	555	578	0.00048
LRR [sensitive, ls]	579	612	2.1
LRR [sensitive, ls]	579	612	43

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	107	595	2e-50
CLV2 [A. thaliana]	108	609	3e-42
Xa21 [O. sativa]	109	611	8e-56
Cf-9 [L. pimpinellifolium]	129	618	5e-34
Xa21 [O. sativa]	151	618	6e-46
FLS2 [A.thaliana]	161	595	2e-45
FLS2 [A.thaliana]	168	622	1e-49
Cf-9 [L. pimpinellifolium]	169	660	9e-52
CLV2 [A. thaliana]	169	615	3e-46
Cf-9 [L. pimpinellifolium]	170	611	1e-31

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6441.m00137

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)