Report for 6441.m00141

 > 6441.m00141, length: 709, copies: 1 

MPFSGLAAAALLLLLLSMANSTIACLEQEKSSLLRFLAGLSHDNGIAMSWRNGIDCCAWEGITCSEDGAIIEVYL

VSKGLEGQISPSLGELRSLLYLNLSYNLLSGGLPEELMSSGSIIVLDVSFNRLDGDLQELNSSVSDRPLQVLNIS

SNRFTGEFPSTTWEKMRSLVAINASNNSFTGQIASSFCTGLPSFAMLDVSYNQFSGSIPPGIGKCTALKVLKAGH

NNISGALPDDLFHATSLECLSFPNNDLQGTIDGVLMIKLSNLVFLDLAWNRFSGTIPDSIGKLKRLQEFHMNNNN

ISGELPSSLGDCTNVITINLENNKLAGELSKVNFSNLHNLQALGLSSNYFTGTIPDSIYSCGTLTWLRLSRNKLQ

GQLTEKLENLKSLTFVSLSYNNFTNITGSLHILKSLRNLTTLLIGSNFIHEAMPEDETIDGFENLHVLAINNCAL

TGKIPNWLSKLKKLELLLLHNNQLSGPIPTWINSLNFLKYIDLSNNSLIGDIPTALMEMPMLKSDKIEDHPDGPR

VSPFTIYVGVSLCFQYRAASAFPKMLNLGNNKLSGLIPVEIGQLKALLSLNLSFNNLHGEIPQSISDIKNLMGLD

LSSNHLTGAIPSALVNLHFLSEFNVSYNDLQGPVPIGGQFSTFPSSSFAGNPKLCSPMLVQHCNLAEAAPTSPTS

TKQYIDKVVFAIGFGVFFGIGVLYDQTIISRYFG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	93	116	1.5
LRR [Pfam ls]	143	167	2.3
LRR [Pfam ls]	168	192	3.4
LRR [Pfam ls]	193	216	4.7
LRR [Pfam ls]	266	289	0.17
LRR [Pfam ls]	290	313	0.3
LRR [Pfam ls]	314	338	6.6
LRR [Pfam ls]	339	362	5.9
LRR [Pfam ls]	363	386	0.37
LRR [Pfam ls]	387	409	6.8
LRR [Pfam ls]	439	462	0.43
LRR [Pfam ls]	463	486	0.38
LRR [Pfam ls]	487	510	0.66
LRR [Pfam ls]	571	594	6.1
LRR [Pfam ls]	595	618	0.68

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	93	116	0.073
LRR [sensitive, ls]	93	116	1.5
LRR [sensitive, ls]	117	139	2.2
LRR [sensitive, ls]	117	139	45
LRR [sensitive, ls]	143	167	0.11
LRR [sensitive, ls]	143	167	2.3
LRR [sensitive, ls]	168	192	0.16
LRR [sensitive, ls]	168	192	3.4
LRR [sensitive, ls]	193	216	0.23
LRR [sensitive, ls]	193	216	4.7
LRR [sensitive, ls]	217	240	0.49
LRR [sensitive, ls]	217	240	10
LRR [sensitive, ls]	241	265	1.6
LRR [sensitive, ls]	241	265	33
LRR [sensitive, ls]	266	289	0.0081
LRR [sensitive, ls]	266	289	0.17
LRR [sensitive, ls]	290	313	0.014
LRR [sensitive, ls]	290	313	0.3
LRR [sensitive, ls]	314	338	0.32
LRR [sensitive, ls]	314	338	6.6
LRR [sensitive, ls]	339	362	0.29
LRR [sensitive, ls]	339	362	5.9
LRR [sensitive, ls]	363	386	0.018
LRR [sensitive, ls]	363	386	0.37
LRR [sensitive, ls]	387	409	0.33
LRR [sensitive, ls]	387	409	6.8
LRR [sensitive, ls]	413	438	2.4
LRR [sensitive, ls]	413	438	49
LRR [sensitive, ls]	439	462	0.021
LRR [sensitive, ls]	439	462	0.43
LRR [sensitive, ls]	463	486	0.018
LRR [sensitive, ls]	463	486	0.38
LRR [sensitive, ls]	487	510	0.032
LRR [sensitive, ls]	487	510	0.66
LRR [sensitive, ls]	547	570	0.53
LRR [sensitive, ls]	547	570	11
LRR [sensitive, ls]	571	594	0.3
LRR [sensitive, ls]	571	594	6.1
LRR [sensitive, ls]	595	618	0.033
LRR [sensitive, ls]	595	618	0.68
LRR [sensitive, ls]	619	652	0.76
LRR [sensitive, ls]	619	652	16

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	6	635	3e-69
Xa21 [O. sativa]	9	655	2e-62
CLV2 [A. thaliana]	16	655	3e-56
Xa21 [O. sativa]	27	323	8e-24
Cf-9 [L. pimpinellifolium]	48	634	2e-36
FLS2 [A.thaliana]	69	655	4e-66
Cf-9 [L. pimpinellifolium]	73	397	8e-22
Cf-9 [L. pimpinellifolium]	75	503	2e-31
Xa21 [O. sativa]	82	256	1e-10
Cf-9 [L. pimpinellifolium]	88	699	2e-56
Xa21 [O. sativa]	169	636	4e-49

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	683	705	out -> in

Report for 6441.m00141

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)