Report for 6441.m00143

 > 6441.m00143, length: 721, copies: 1 

MKPIPHFSCSNKTSRFCINFFGPVLVLLLFTFISPVGSCTERERRSLLQFLTRLSQDGGLAASWQNSTDCCTWEG

IICGEDGAVTELLLASRGLQGCISSSLSELTSLSRLNLSYNLLSSELPSELIFSSIVVLDVSFNRLDGELQELNS

SSPDRPLQVLNISSNLFTGAFPSTTWEKMSNLVAINASNNSFSGHIPSSFCISSPSFAVLDLSYNQFSGSIPPGI

GKCSSLRMLRVGQNNIIGTLPDDLFRATSLEYLSFPNNHLQGIIDDALMIKLSNLGFLDLGGNRFSGKIPDSIGQ

LKRLEELHMEENNISGELPPTLGDCTNLVTINLKKNKLKGELAKVNFSTLPNLKILDLSSNYFIGTIPESIYSCS

NLTWLRLSTNKLHGELTKKIENLKSITFISLSYNNFKNITNTLHILKNLRNLTVLLLGGNFMHEAMPEDETIDGF

KNIQGLGINDCALTGKIPNWLSKLRSLQLLALYNNQLSGPIPTWISSLNFLKYVDISNNSLTGEIPTALMQMPML

KSDKIEDHPDLIVSPFTVYVGACLCFQYRATSAFPKMLNLGNNKLSGVIPMEIGQLKELLSLNLSFNNLNGEIPQ

AISNLKNLMVLDLSSNHLTGPIPSGLVNLHFLSEFNVSYNDLEGPVPIGGQFSTFLSSSFAGNPKLCSPMLEHHC

NSAVAAPTTPISAKQYIDKVVFAIAFGVFFGVGVLYDQITMPRYFG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	156	180	7.8
LRR [Pfam ls]	181	205	8.1
LRR [Pfam ls]	206	229	0.32
LRR [Pfam ls]	254	276	7.5
LRR [Pfam ls]	279	302	0.22
LRR [Pfam ls]	303	326	0.088
LRR [Pfam ls]	327	351	3.6
LRR [Pfam ls]	352	375	0.51
LRR [Pfam ls]	376	399	5.4
LRR [Pfam ls]	452	475	4.3
LRR [Pfam ls]	476	499	0.22
LRR [Pfam ls]	500	523	0.31
LRR [Pfam ls]	583	606	0.16
LRR [Pfam ls]	607	630	0.23

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	107	127	0.61
LRR [sensitive, ls]	107	127	13
LRR [sensitive, ls]	130	152	0.9
LRR [sensitive, ls]	130	152	19
LRR [sensitive, ls]	156	180	0.38
LRR [sensitive, ls]	156	180	7.8
LRR [sensitive, ls]	181	205	0.39
LRR [sensitive, ls]	181	205	8.1
LRR [sensitive, ls]	206	229	0.016
LRR [sensitive, ls]	206	229	0.32
LRR [sensitive, ls]	230	253	0.46
LRR [sensitive, ls]	230	253	9.5
LRR [sensitive, ls]	254	276	0.36
LRR [sensitive, ls]	254	276	7.5
LRR [sensitive, ls]	279	302	0.011
LRR [sensitive, ls]	279	302	0.22
LRR [sensitive, ls]	303	326	0.0042
LRR [sensitive, ls]	303	326	0.088
LRR [sensitive, ls]	327	351	0.17
LRR [sensitive, ls]	327	351	3.6
LRR [sensitive, ls]	352	375	0.024
LRR [sensitive, ls]	352	375	0.51
LRR [sensitive, ls]	376	399	0.26
LRR [sensitive, ls]	376	399	5.4
LRR [sensitive, ls]	400	422	0.61
LRR [sensitive, ls]	400	422	13
LRR [sensitive, ls]	426	451	1.3
LRR [sensitive, ls]	426	451	28
LRR [sensitive, ls]	452	475	0.21
LRR [sensitive, ls]	452	475	4.3
LRR [sensitive, ls]	476	499	0.01
LRR [sensitive, ls]	476	499	0.22
LRR [sensitive, ls]	500	523	0.015
LRR [sensitive, ls]	500	523	0.31
LRR [sensitive, ls]	559	582	0.96
LRR [sensitive, ls]	559	582	20
LRR [sensitive, ls]	583	606	0.0078
LRR [sensitive, ls]	583	606	0.16
LRR [sensitive, ls]	607	630	0.011
LRR [sensitive, ls]	607	630	0.23
LRR [sensitive, ls]	631	664	4.1
LRR [sensitive, ls]	631	664	84

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	16	710	2e-54
Cf-9 [L. pimpinellifolium]	24	711	1e-62
FLS2 [A.thaliana]	24	647	9e-72
Xa21 [O. sativa]	46	674	1e-65
FLS2 [A.thaliana]	84	667	2e-66
FLS2 [A.thaliana]	258	657	1e-37
FLS2 [A.thaliana]	290	670	1e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	16	38	in -> out
putative TM domain	695	711	out -> in

Report for 6441.m00143

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)