Report for 6441.m00145

 > 6441.m00145, length: 719, copies: 1 

MKPQSWRSNKTRRFCINFFDPALVLLLLTFISPVDSCTKQERHSLLRFLAGLSQDGGLAVSWQNSPNCCTWEGII

CGEDGAVTELLLASRGLQGCISSSLSELTSLSRLNLSYNLLSDGLPSELISTSSIVVLDVSFNRLDGELHELNSS

SPDRPLQVLNISSNLFTGAFPSTTWEKMSNLFAINASNNSFTGYIPSTFCISSSSFAMLDLSYNQFSGNIPHGIG

KCCSLRMLKAGHNNIIGTLPDDLFSATSLEYLSFANNGLQGTINGALIIKLSNLVFVDLGWNRSSGKIPNSIGQL

KRLEELHMSSNNLSGELPSSLGECTYLVTINLSSNKFTGELANVNFSNLPNLKALDFSGNDFTGTIPESIYSCSN

LTSLRLSANRLHGQLTKNIGNLKSIIFLSISYNNFTNITNTLHILKSLRNLSVLFMGSNFKNEAMPQDEKIDGFK

NILGLGINDCALSGKVPNWFSKLRNLQVLVLYNNQLSGPIPTWINSLNFLKYVDISNNSLSGEIPAALTEMPMLK

SDKIADYTDPRLFQFPVYVGCMCFQYRTITAFPKMLNLGNNKLTGAIPMEIGELKALVSLNLSFNNLNGEIPQLV

TNLRNLMVLDLSYNHLTGAIPSALVSLHFLSEFNISYNDLEGPVPIGGQFSTFPSSSFAGNPKLCSPMLVHHCNL

AEAAPTSPTSRKQYIDQVVFAIAFGVFFGVGVLYDQLIMPRYFG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	105	128	4.1
LRR [Pfam ls]	155	179	7.8
LRR [Pfam ls]	253	277	1.6
LRR [Pfam ls]	302	325	0.04
LRR [Pfam ls]	326	350	0.36
LRR [Pfam ls]	351	374	0.28
LRR [Pfam ls]	375	398	3.4
LRR [Pfam ls]	475	498	0.032
LRR [Pfam ls]	499	522	0.19
LRR [Pfam ls]	581	604	0.81
LRR [Pfam ls]	605	628	0.13

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	105	128	0.2
LRR [sensitive, ls]	105	128	4.1
LRR [sensitive, ls]	129	151	0.89
LRR [sensitive, ls]	129	151	18
LRR [sensitive, ls]	155	179	0.38
LRR [sensitive, ls]	155	179	7.8
LRR [sensitive, ls]	180	203	1.9
LRR [sensitive, ls]	180	203	39
LRR [sensitive, ls]	205	228	0.81
LRR [sensitive, ls]	205	228	17
LRR [sensitive, ls]	229	252	0.5
LRR [sensitive, ls]	229	252	10
LRR [sensitive, ls]	253	277	0.077
LRR [sensitive, ls]	253	277	1.6
LRR [sensitive, ls]	302	325	0.0019
LRR [sensitive, ls]	302	325	0.04
LRR [sensitive, ls]	326	350	0.017
LRR [sensitive, ls]	326	350	0.36
LRR [sensitive, ls]	351	374	0.013
LRR [sensitive, ls]	351	374	0.28
LRR [sensitive, ls]	375	398	0.16
LRR [sensitive, ls]	375	398	3.4
LRR [sensitive, ls]	399	421	0.89
LRR [sensitive, ls]	399	421	18
LRR [sensitive, ls]	451	474	1
LRR [sensitive, ls]	451	474	21
LRR [sensitive, ls]	475	498	0.0015
LRR [sensitive, ls]	475	498	0.032
LRR [sensitive, ls]	499	522	0.0093
LRR [sensitive, ls]	499	522	0.19
LRR [sensitive, ls]	557	580	1.1
LRR [sensitive, ls]	557	580	24
LRR [sensitive, ls]	581	604	0.039
LRR [sensitive, ls]	581	604	0.81
LRR [sensitive, ls]	605	628	0.0063
LRR [sensitive, ls]	605	628	0.13
LRR [sensitive, ls]	629	662	0.66
LRR [sensitive, ls]	629	662	14

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	14	665	6e-55
FLS2 [A.thaliana]	24	645	1e-69
Xa21 [O. sativa]	44	697	1e-62
Cf-9 [L. pimpinellifolium]	60	709	2e-61
FLS2 [A.thaliana]	77	665	3e-63
FLS2 [A.thaliana]	426	661	4e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	32	in -> out
putative TM domain	692	709	out -> in

Report for 6441.m00145

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)