Report for 6441.m00146

 > 6441.m00146, length: 710, copies: 1 

MPFSGLAASSLCLLLFLLPMAVSTIACLEQEKSSLLRFLAGLSHDNGIAMSWRNGMDCCEWEGITCSEDGAVIEV

SLASKGLEGRISPSLGELTSLSRLNLSYNSLSGGLPAELMSSGSIVVLDVSFNHLNGNLQELNSSVSNQPLQVLN

ISSNQFTGAFPSSTWEKMSNLVAINVSNNSFTGHIPSSFCIGSPSFAVIDIGYNQFSGSIPPGIGNCTALRMLKA

GNNNISGALPDDLFHATSLEYLSFANNGLQGTINGSLIIKLSNLVFVDLGWNRFSGKIPNSIGQLKRLKELHISS

NNLSGELPASLGDCTNLVIINLSTNKFTGELAKVNFSNLPNLKALDFSWNNFNGTIPESIYSCSNLTWLRLSANR

LHGQLSKNIGNLKSITFLSISYNNFTNITNTLHILKSLRNLTVLFMGSNFKNEAMPQDEAIDGFENIQGLAIERC

ALYGKIPNWLSKLRNLQVLTLYSNQLSGPIPTWINSLNFLKYVDVSNNSLTGEIPAALMEMPMLKSDKVADNSEQ

RAFTFSFYAGACLCLQYHTTTALPEMLNLGNNNFTGVIPMEIGELKELVSLNLSFNNLNGEIPESISNLKNLMVL

DLSYNHLTGAIPPAMVNLHFLSEFNVSYNDLKGPVPSGDQFSTFPSSSFAGNPKLCSPMLVHHCNSAEAAPTSTI

LTKQYIDKVVFAIAFGVFFGVGVLYDQIIMYKYFG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	95	118	1.2
LRR [Pfam ls]	145	169	2.8
LRR [Pfam ls]	170	194	1.2
LRR [Pfam ls]	195	218	5.8
LRR [Pfam ls]	243	267	0.7
LRR [Pfam ls]	268	291	3.1
LRR [Pfam ls]	292	315	0.041
LRR [Pfam ls]	316	340	0.36
LRR [Pfam ls]	341	364	5.9
LRR [Pfam ls]	365	388	1.3
LRR [Pfam ls]	389	411	7.5
LRR [Pfam ls]	465	488	0.082
LRR [Pfam ls]	489	512	0.35
LRR [Pfam ls]	572	595	0.03
LRR [Pfam ls]	596	619	0.21

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	0.059
LRR [sensitive, ls]	95	118	1.2
LRR [sensitive, ls]	119	141	1.6
LRR [sensitive, ls]	119	141	33
LRR [sensitive, ls]	145	169	0.13
LRR [sensitive, ls]	145	169	2.8
LRR [sensitive, ls]	170	194	0.057
LRR [sensitive, ls]	170	194	1.2
LRR [sensitive, ls]	195	218	0.28
LRR [sensitive, ls]	195	218	5.8
LRR [sensitive, ls]	219	242	0.64
LRR [sensitive, ls]	219	242	13
LRR [sensitive, ls]	243	267	0.034
LRR [sensitive, ls]	243	267	0.7
LRR [sensitive, ls]	268	291	0.15
LRR [sensitive, ls]	268	291	3.1
LRR [sensitive, ls]	292	315	0.002
LRR [sensitive, ls]	292	315	0.041
LRR [sensitive, ls]	316	340	0.017
LRR [sensitive, ls]	316	340	0.36
LRR [sensitive, ls]	341	364	0.28
LRR [sensitive, ls]	341	364	5.9
LRR [sensitive, ls]	365	388	0.063
LRR [sensitive, ls]	365	388	1.3
LRR [sensitive, ls]	389	411	0.36
LRR [sensitive, ls]	389	411	7.5
LRR [sensitive, ls]	441	464	2.2
LRR [sensitive, ls]	441	464	47
LRR [sensitive, ls]	465	488	0.0039
LRR [sensitive, ls]	465	488	0.082
LRR [sensitive, ls]	489	512	0.017
LRR [sensitive, ls]	489	512	0.35
LRR [sensitive, ls]	548	571	1.1
LRR [sensitive, ls]	548	571	24
LRR [sensitive, ls]	572	595	0.0014
LRR [sensitive, ls]	572	595	0.03
LRR [sensitive, ls]	596	619	0.01
LRR [sensitive, ls]	596	619	0.21
LRR [sensitive, ls]	620	653	0.8
LRR [sensitive, ls]	620	653	17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	11	636	2e-78
CLV2 [A. thaliana]	18	699	9e-61
Xa21 [O. sativa]	31	656	1e-62
Cf-9 [L. pimpinellifolium]	50	640	3e-50
Cf-9 [L. pimpinellifolium]	67	700	3e-54
FLS2 [A.thaliana]	71	656	6e-66

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	5	27	out -> in
putative TM domain	684	706	in -> out

Report for 6441.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)