Report for 6441.m00154

 > 6441.m00154, length: 386, copies: 1 

MHPLHSPCKKHSNKFPIPVLALALVLLINLASLTSSCTEQDRSSLLRFLRELSQDGGLAASWQDGTDCCKWDGIT

CSQDSTVTDVSLASRSLQGRISPSLGNLPGLLRLNLSHNLLSGALPKELLSSSSLITIDVSFNRLDGDLDELPSS

TPARPLQVLNISSNLLAGQFPSSTWVVMKNMVALNVSNNSFSGHIPANFCTNSPYLSVLELSYNQLSGSIPPGFG

SCSRLRVLKAGHNNLSGTIPDEIFNATSLECLSFPNNDFQGTLEWANVVKLSKLATLDLGENNFSGNISESIGQL

NRLEELHLNNNKMFGSIPSNLSNCTSLKIIDLNNNNFSGELIYVNFSNLPNLKTLDLMRNNFSGEIPESIYTCSN

LTALRETVLQT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	180	204	1.8
LRR [Pfam ls]	205	228	0.04
LRR [Pfam ls]	229	253	0.38
LRR [Pfam ls]	278	301	1.7
LRR [Pfam ls]	302	325	0.043
LRR [Pfam ls]	326	350	0.2
LRR [Pfam ls]	351	374	3.5

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	81	104	5
LRR [sensitive, ls]	81	104	100
LRR [sensitive, ls]	105	128	0.48
LRR [sensitive, ls]	105	128	10
LRR [sensitive, ls]	129	151	1.2
LRR [sensitive, ls]	129	151	25
LRR [sensitive, ls]	155	179	0.73
LRR [sensitive, ls]	155	179	15
LRR [sensitive, ls]	180	204	0.087
LRR [sensitive, ls]	180	204	1.8
LRR [sensitive, ls]	205	228	0.0019
LRR [sensitive, ls]	205	228	0.04
LRR [sensitive, ls]	229	253	0.018
LRR [sensitive, ls]	229	253	0.38
LRR [sensitive, ls]	278	301	0.082
LRR [sensitive, ls]	278	301	1.7
LRR [sensitive, ls]	302	325	0.0021
LRR [sensitive, ls]	302	325	0.043
LRR [sensitive, ls]	326	350	0.0097
LRR [sensitive, ls]	326	350	0.2
LRR [sensitive, ls]	351	374	0.17
LRR [sensitive, ls]	351	374	3.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	14	338	2e-32
FLS2 [A.thaliana]	20	379	1e-32
Xa21 [O. sativa]	33	320	5e-25
CLV2 [A. thaliana]	40	379	1e-28
Xa21 [O. sativa]	41	375	8e-32
Cf-9 [L. pimpinellifolium]	61	379	2e-21
Cf-9 [L. pimpinellifolium]	75	318	1e-13
FLS2 [A.thaliana]	77	292	6e-20
Cf-9 [L. pimpinellifolium]	78	368	1e-22
Cf-9 [L. pimpinellifolium]	80	381	9e-29
FLS2 [A.thaliana]	80	379	4e-35
FLS2 [A.thaliana]	80	380	8e-33
FLS2 [A.thaliana]	80	379	1e-32
Xa21 [O. sativa]	80	379	5e-23
FLS2 [A.thaliana]	82	379	5e-28
Xa21 [O. sativa]	85	370	8e-29
Cf-9 [L. pimpinellifolium]	87	379	8e-25
CLV2 [A. thaliana]	87	368	9e-26
FLS2 [A.thaliana]	87	360	5e-27
CLV2 [A. thaliana]	89	379	8e-28
CLV2 [A. thaliana]	106	371	3e-31
Xa21 [O. sativa]	181	377	3e-27
Xa21 [O. sativa]	276	379	1e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	15	37	out -> in

Report for 6441.m00154

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)