Report for 6487.m00130

 > 6487.m00130, length: 828, copies: 1 

MRSAYHLMPPLAMLLIHGLADHASSTEAPAACLPDQASALLQLKRSFNATIGDYPAAFRSWVAGADCCHWDGVRC

GGAGGRVTSLDLSHRDLQASSGLDDALFSLTSLEYLDLSSNDFSKSKLPATGFEMLTGLTHLDLSNTNFAGLVPA

GIGRLTSLNYLDLSTTFFVEELDDEYSITYYYSDTMAQLSEPSLETLLANLTNLEELRLGMVMVNMSSNYGTARW

CDAMARSSPKLRVISMPYCSLSGPICHSLSALRSLSVIELHYNHLSGPVPEFLAALPSLSVLQLSNNMFEGVFPP

IIFQHEKLTTINLTKNLGISGNLPTSFSGDSSLQSLSVSNTNFSGTIPGSISNLRSLKELALGASGFSGVLPSSI

GQLKSLSLLEVSGLELVGSIPSWISNLTSLTVLKFFSCGLSGPITTPDQVISDGPKPSPLTGLVLHLHEITFLDL

SYNQIQGAIPLWAWKTLNLGFALFNLSHNKFTSIGSDHPLLPVYIEFFDLSFNNIEGVIPIPKEGSVTLDYSNNR

FSSLPLNFSTYLSNTVLFKASNNSISGNIPPSICDRIKSLQLIDLSNNNLTGLIPSCLMEDADALQVLSLKDNHL

TGELPDNIKEGCALSALDFSGNSIQGQLPRSLVACRNLEILDIGNNKISDSFPCWMSKLPQLQVLVLKSNKFIGQ

ILDPSYTGGGNNCQFTKLQFADMSSNNLSGTLPEEWFKMLKSMIMDTCDNDMLMREQHLYYRGKMQSYQFTAGIS

YKGSGLTISKTLRTLVLIDVSNNAFHGRIPRSIGELVLLRALNMSHNALTGPIPVQFANLKQLELLDLSSNELSG

EIL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	107	132	0.061
LRR [Pfam ls]	133	156	0.39
LRR [Pfam ls]	259	282	0.19
LRR [Pfam ls]	332	355	0.1
LRR [Pfam ls]	380	403	4.9
LRR [Pfam ls]	444	468	0.19
LRR [Pfam ls]	564	585	0.099
LRR [Pfam ls]	589	609	5.3
LRR [Pfam ls]	637	660	0.12
LRR [Pfam ls]	692	716	0.49
LRR [Pfam ls]	788	811	0.35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	81	106	0.48
LRR [sensitive, ls]	81	106	11
LRR [sensitive, ls]	107	132	0.0027
LRR [sensitive, ls]	107	132	0.061
LRR [sensitive, ls]	133	156	0.017
LRR [sensitive, ls]	133	156	0.39
LRR [sensitive, ls]	235	258	0.32
LRR [sensitive, ls]	235	258	7.3
LRR [sensitive, ls]	259	282	0.0085
LRR [sensitive, ls]	259	282	0.19
LRR [sensitive, ls]	283	306	0.39
LRR [sensitive, ls]	283	306	8.9
LRR [sensitive, ls]	307	331	0.72
LRR [sensitive, ls]	307	331	16
LRR [sensitive, ls]	332	355	0.0047
LRR [sensitive, ls]	332	355	0.1
LRR [sensitive, ls]	356	379	1
LRR [sensitive, ls]	356	379	22
LRR [sensitive, ls]	380	403	0.22
LRR [sensitive, ls]	380	403	4.9
LRR [sensitive, ls]	404	430	4.2
LRR [sensitive, ls]	404	430	95
LRR [sensitive, ls]	444	468	0.0087
LRR [sensitive, ls]	444	468	0.19
LRR [sensitive, ls]	470	489	2
LRR [sensitive, ls]	470	489	45
LRR [sensitive, ls]	494	515	1.9
LRR [sensitive, ls]	494	515	42
LRR [sensitive, ls]	539	563	1.6
LRR [sensitive, ls]	539	563	35
LRR [sensitive, ls]	564	585	0.0044
LRR [sensitive, ls]	564	585	0.099
LRR [sensitive, ls]	589	609	0.24
LRR [sensitive, ls]	589	609	5.3
LRR [sensitive, ls]	613	636	0.52
LRR [sensitive, ls]	613	636	12
LRR [sensitive, ls]	637	660	0.0052
LRR [sensitive, ls]	637	660	0.12
LRR [sensitive, ls]	692	716	0.022
LRR [sensitive, ls]	692	716	0.49
LRR [sensitive, ls]	764	787	0.38
LRR [sensitive, ls]	764	787	8.5
LRR [sensitive, ls]	788	811	0.015
LRR [sensitive, ls]	788	811	0.35

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	13	827	1e-88
CLV2 [A. thaliana]	35	710	1e-42
Xa21 [O. sativa]	39	653	1e-41
FLS2 [A.thaliana]	41	827	4e-61
Cf-9 [L. pimpinellifolium]	82	653	1e-39
FLS2 [A.thaliana]	86	653	1e-44
Cf-9 [L. pimpinellifolium]	87	471	5e-13
FLS2 [A.thaliana]	98	394	6e-22
Xa21 [O. sativa]	183	676	2e-34
CLV2 [A. thaliana]	215	828	2e-51
Xa21 [O. sativa]	243	827	2e-45

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6487.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)