Report for 6522.m00161

 > 6522.m00161, length: 871, copies: 1 

MAGARATALSCFSLLLFCSYALVSPGSSDATVVDELALLSFKSMLSGPSDGLLASWNTSIHYCDWTGVVCSGRRQ

PERVVALLMNSSSLSGRISPFLGNLSFLNRLDLHGNGFIGQIPSELGHLSRLRVLNLSTNSLDGSIPVALGRCTN

LTVLDLSSNKLRDKIPTEVGALENLVDLRLHKNGLSGEIPLHISNLLSVEYLYLRDNWFSGEIPPALGNLTKLRY

LDLASNKLSGSIPSSLGQLSSLSLFNLGHNNLSGLIPNSIWNISSLTVLSVQVNMLSGTIPPNAFDSLPRLQSIS

MDTNKFEGYIPASLANASNLSFVQLSGNSLRGIVPPKIGRLSNINWLQLSNNLLQAKETKDWNFISALTNCSQLE

MLDLGANKFSGVLPDSLSNHSSSLWFLSLSVNEITGSIPKDIGLENLDLSSNNLSGQVPKFFGNITILYYLNLSF

NSFVGDIPNFGVFANATAISIQGNDKLCGGIPDLHLPPCSSESGKRRHKFPLIPVVVSLAATIFILSLISAFLFW

RKPMSKLPSATSMQGYPLISYQQIVRATDDFSTTNLLGSGTFGTVFKGNISAQDGENTSLVAIKVLKLQTPGALK

SFSAECEALRDLRHRNLVKIITVCSSIDNRGNDFKAIVLDFMSNGSLEGWLHPDKNDQTDQRYLSLLERVCVLLD

VAYGLDYLHCHGPTPVVHCDLKSSNVLLDADMVAHVGDFGLAKILVEGSSMFQQSTSSMGFRGTIGYAAPEYGAG

NMVSTNGDIYSYGILVLETVTGKKPAGSEFRQGLSLREYVKSGLEDEVMEIVDMRLCMDLTNGIPTGNDATYKRK

VECIVLLLKLGMSCSQELPSSRSSTGDIVKELLAIKESLSGDEHKM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	0.23
LRR [Pfam ls]	126	149	0.28
LRR [Pfam ls]	150	173	0.025
LRR [Pfam ls]	174	197	1.7
LRR [Pfam ls]	198	221	0.0059
LRR [Pfam ls]	222	245	0.0031
LRR [Pfam ls]	246	269	0.97
LRR [Pfam ls]	270	294	0.011
LRR [Pfam ls]	373	396	0.45
LRR [Pfam ls]	418	441	0.062
Ser/Thr pkinase [Pfam fs]	556	775	3.2e-45
Ser/Thr pkinase [Pfam ls]	556	859	1e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	78	101	4.9
LRR [sensitive, ls]	78	101	53
LRR [sensitive, ls]	102	125	0.021
LRR [sensitive, ls]	102	125	0.23
LRR [sensitive, ls]	126	149	0.026
LRR [sensitive, ls]	126	149	0.28
LRR [sensitive, ls]	150	173	0.0023
LRR [sensitive, ls]	150	173	0.025
LRR [sensitive, ls]	174	197	0.15
LRR [sensitive, ls]	174	197	1.7
LRR [sensitive, ls]	198	221	0.00053
LRR [sensitive, ls]	198	221	0.0059
LRR [sensitive, ls]	222	245	0.00028
LRR [sensitive, ls]	222	245	0.0031
LRR [sensitive, ls]	246	269	0.089
LRR [sensitive, ls]	246	269	0.97
LRR [sensitive, ls]	270	294	0.001
LRR [sensitive, ls]	270	294	0.011
LRR [sensitive, ls]	295	318	1.6
LRR [sensitive, ls]	295	318	18
LRR [sensitive, ls]	319	342	0.51
LRR [sensitive, ls]	319	342	5.6
LRR [sensitive, ls]	343	369	0.86
LRR [sensitive, ls]	343	369	9.5
LRR [sensitive, ls]	373	396	0.041
LRR [sensitive, ls]	373	396	0.45
LRR [sensitive, ls]	418	441	0.0057
LRR [sensitive, ls]	418	441	0.062
LRR [sensitive, ls]	442	464	0.6
LRR [sensitive, ls]	442	464	6.5
LRR [sensitive, ls]	465	488	6.6
LRR [sensitive, ls]	465	488	73

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	474	1e-101
Cf-9 [L. pimpinellifolium]	13	465	1e-37
FLS2 [A.thaliana]	22	484	2e-58
CLV2 [A. thaliana]	34	460	3e-43
FLS2 [A.thaliana]	37	475	5e-61
FLS2 [A.thaliana]	48	861	1e-108
CLV2 [A. thaliana]	62	488	2e-43
Xa21 [O. sativa]	66	264	5e-29
Cf-9 [L. pimpinellifolium]	77	525	1e-42
CLV2 [A. thaliana]	77	524	2e-37
Xa21 [O. sativa]	79	333	9e-31
Cf-9 [L. pimpinellifolium]	82	475	4e-37
Xa21 [O. sativa]	86	670	1e-128
Cf-9 [L. pimpinellifolium]	216	475	2e-19
Rpg1 [Hordeum vulgare]	545	774	2e-22
Pto [L. esculentum]	547	806	2e-22
Rpg1 [Hordeum vulgare]	553	774	6e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	441	463	out -> in
putative TM domain	503	525	in -> out

Report for 6522.m00161

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)