Report for 6538.m00122

 > 6538.m00122, length: 1015, copies: 1 

MSSSTKRVTHHLPSLLLTVMHILLPVQATTNLTARTSSSIPPVPCHPDQASALLRLKHSFDATVGDYSTAFRSWV

AGTDCCRWDGVGCGSADGRVTSLDLGGQNLQAGSVDPALFRLTSLKHLNLSSNNFSMSQLPVITGFERLTELVYL

DLSDTNIAGELPASIGRLTNLVYLDLSTSFYIVEYNDDEQVTFNSDSVWQLSAPNMETLLENLSNLEELHMGMVD

LSGNGERWCYNIAKYTPKLQVLSLPYCSLSGPICASFSSLQALTMIELHYNRLSGSVPEFLAGFSNLTVLQLSRN

KFQGSFPPIIFQHKKLRTINLSKNPGISGNLPNFSQDTSLENLFLNNTNFTGTIPGSIINLISVKKLDLGASGFS

GSLPSSLGSLKYLDMLQLSGLELVGTIPSWISNLTSLTVLRISNCGLSGPVPSSIGNLRELTTLALYNCNFSGTV

PPQILNLTRLQTLLLHSNNFAGTVDLTSFSKLKNLTFLNLSNNKLLVVEGKNSSSLVSFPKLQLLSLASCSMTTF

PNILRDLPDITSLDLSNNQIQGAIPQWAWKTWKGLQFIVLNISHNNFTSLGSDPFLPLYVEYFDLSFNSIEGPIP

IPQEGSSTLDYSSNQFSYMPLRYSTYLGETVTFKASKNKLSGNVPPLICTTARKLQLIDLSYNNLSGSIPSCLLE

SFSELQVLSLKANKFVGKLPDIIKEGCALEALDLSDNSIEGKIPRSLVSCRNLEILDIGSNQISDSFPCWLSQLP

KLQVLVLKSNKLTGQVMDPSYTGRQISCEFPALRIADMASNNLNGMLMEGWFKMLKSMMARSDNDTLVMENQYYH

GQTYQFTATVTYKGNDRTISKILRSLVLIDVSSNAFHGAIPDTIGELVLLRGLNLSHNALTGPIPSQFGRLDQLE

SLDLSFNELSGEIPKELASLNFLSTLNLANNTLVGRIPDSYQFSTFSNSSFLGNTGLCGPPLSRQCDNPEEPIAI

PYTSEKSIDAVLLLFTALGFGISFAMTILIVWGSHMRKRH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	142	0.54
LRR [Pfam ls]	146	169	0.34
LRR [Pfam ls]	243	266	1
LRR [Pfam ls]	267	290	3.4
LRR [Pfam ls]	291	314	0.29
LRR [Pfam ls]	315	338	2.6
LRR [Pfam ls]	339	362	5.5
LRR [Pfam ls]	411	434	0.015
LRR [Pfam ls]	435	458	0.59
LRR [Pfam ls]	459	483	1.1
LRR [Pfam ls]	484	507	4.1
LRR [Pfam ls]	511	533	0.41
LRR [Pfam ls]	534	558	0.099
LRR [Pfam ls]	561	584	3
LRR [Pfam ls]	654	678	0.0022
LRR [Pfam ls]	703	726	0.7
LRR [Pfam ls]	727	750	0.087
LRR [Pfam ls]	874	897	0.86
LRR [Pfam ls]	898	921	0.0048

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	94	118	0.33
LRR [sensitive, ls]	94	118	7.5
LRR [sensitive, ls]	119	142	0.024
LRR [sensitive, ls]	119	142	0.54
LRR [sensitive, ls]	146	169	0.015
LRR [sensitive, ls]	146	169	0.34
LRR [sensitive, ls]	170	202	4
LRR [sensitive, ls]	170	202	90
LRR [sensitive, ls]	243	266	0.047
LRR [sensitive, ls]	243	266	1
LRR [sensitive, ls]	267	290	0.15
LRR [sensitive, ls]	267	290	3.4
LRR [sensitive, ls]	291	314	0.013
LRR [sensitive, ls]	291	314	0.29
LRR [sensitive, ls]	315	338	0.11
LRR [sensitive, ls]	315	338	2.6
LRR [sensitive, ls]	339	362	0.24
LRR [sensitive, ls]	339	362	5.5
LRR [sensitive, ls]	363	386	0.34
LRR [sensitive, ls]	363	386	7.6
LRR [sensitive, ls]	387	410	0.42
LRR [sensitive, ls]	387	410	9.3
LRR [sensitive, ls]	411	434	0.00068
LRR [sensitive, ls]	411	434	0.015
LRR [sensitive, ls]	435	458	0.026
LRR [sensitive, ls]	435	458	0.59
LRR [sensitive, ls]	459	483	0.05
LRR [sensitive, ls]	459	483	1.1
LRR [sensitive, ls]	484	507	0.18
LRR [sensitive, ls]	484	507	4.1
LRR [sensitive, ls]	511	533	0.018
LRR [sensitive, ls]	511	533	0.41
LRR [sensitive, ls]	534	558	0.0044
LRR [sensitive, ls]	534	558	0.099
LRR [sensitive, ls]	561	584	0.13
LRR [sensitive, ls]	561	584	3
LRR [sensitive, ls]	654	678	9.7e-05
LRR [sensitive, ls]	654	678	0.0022
LRR [sensitive, ls]	703	726	0.031
LRR [sensitive, ls]	703	726	0.7
LRR [sensitive, ls]	727	750	0.0039
LRR [sensitive, ls]	727	750	0.087
LRR [sensitive, ls]	751	784	1.6
LRR [sensitive, ls]	751	784	37
LRR [sensitive, ls]	850	873	0.37
LRR [sensitive, ls]	850	873	8.2
LRR [sensitive, ls]	874	897	0.038
LRR [sensitive, ls]	874	897	0.86
LRR [sensitive, ls]	898	921	0.00022
LRR [sensitive, ls]	898	921	0.0048
LRR [sensitive, ls]	922	944	0.9
LRR [sensitive, ls]	922	944	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	37	1009	1e-103
CLV2 [A. thaliana]	48	718	3e-48
Xa21 [O. sativa]	81	600	4e-43
FLS2 [A.thaliana]	103	620	5e-44
Xa21 [O. sativa]	119	743	3e-49
FLS2 [A.thaliana]	247	1006	1e-75
Xa21 [O. sativa]	247	766	7e-43
Xa21 [O. sativa]	315	797	2e-36
CLV2 [A. thaliana]	342	967	2e-55
Xa21 [O. sativa]	364	959	3e-47
CLV2 [A. thaliana]	374	961	3e-32
Xa21 [O. sativa]	415	959	3e-36
Xa21 [O. sativa]	632	980	8e-26
FLS2 [A.thaliana]	660	960	3e-18
Xa21 [O. sativa]	806	940	1e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	985	1007	out -> in

Report for 6538.m00122

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)