Report for 6554.m00161

 > 6554.m00161, length: 792, copies: 1 

MLMLGPFPAHHRCTLFLLLTVTLLPSLAAAAAAHHHHVHAAGDGVVISQADYQGLQAIKHDLSDPYAFLRSWNDT

GLGACSGAWVGIKCVQGKVVAITLPWRGLAGTLSERIGQLTQLRRLSLHDNAISGPIPTSLGFLPDLRGVYLFNN

RFSGAVPASIGNCVALQAFDASNNLLTGAIPSSLANSTKLMRLNLSHNTISGDIPPELAASPSLVFLSLSHNKLS

GHIPDTFAGSKAPSSSSLKESITGTYNLAVLELSHNSLDGPIPESLSGLQKLQVVDLAGNRLNGTIPNKLGSLAD

LKTLDLSGNALTGEIPASLSNLTTSLQAFNVSNNNLSGAVPASLAQKFGPSAFAGNIQLCGYSASVPCPTSPSPS

PSAPASPAQSREATGRHRKFTTKELALIIAGIVVGILLFLALCCMLLCFLTKKRSGSGGKQTTSSKAAGGGAGAA

AGGGRGEKPGSGAAEVESGGEVGGKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKATLEDGSLVAVKRLREK

ITKGHKDFESEAAVLGKIRHPNLLPLRAYYLGPKGEKLLVLDFMPNGSLSQFLHARAPNTPISWETRMTIAKGTA

RGLAFLHDDMTIVHGNLTASNVLLDDHSNPKIADFGLSRLMTTAANSNVLAAAGALGYRAPELSKLKKASAKTDV

YSLGVIILELLTGKSPAETTNGMDLPQWVASIVKEEWTSEVFDLELMRDGDNGPAGDELVDTLKLALHCVDQSPS

VRPDAREVLRQLEQIRPGPEGGAGPSEEGGAGHVAAASAGNE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	117	140	0.024
LRR [Pfam ls]	189	212	0.11
LRR [Pfam ls]	213	236	0.011
LRR [Pfam ls]	252	275	0.0055
LRR [Pfam ls]	276	299	0.18
LRR [Pfam fs]	300	323	4.1e-05
LRR [Pfam ls]	300	323	0.00071
LRR [Pfam ls]	325	349	5
Ser/Thr pkinase [Pfam ls]	492	765	5.9e-41
Ser/Thr pkinase [Pfam fs]	502	691	4.6e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	117	140	0.0022
LRR [sensitive, ls]	117	140	0.024
LRR [sensitive, ls]	141	164	2
LRR [sensitive, ls]	141	164	22
LRR [sensitive, ls]	165	188	0.62
LRR [sensitive, ls]	165	188	6.7
LRR [sensitive, ls]	189	212	0.0096
LRR [sensitive, ls]	189	212	0.11
LRR [sensitive, ls]	213	236	0.001
LRR [sensitive, ls]	213	236	0.011
LRR [sensitive, ls]	252	275	0.0005
LRR [sensitive, ls]	252	275	0.0055
LRR [sensitive, ls]	276	299	0.016
LRR [sensitive, ls]	276	299	0.18
LRR [sensitive, ls]	300	323	6.4e-05
LRR [sensitive, ls]	300	323	0.00071
LRR [sensitive, ls]	325	349	0.45
LRR [sensitive, ls]	325	349	5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	40	344	3e-36
FLS2 [A.thaliana]	49	344	5e-37
CLV2 [A. thaliana]	75	346	3e-25
Xa21 [O. sativa]	77	579	4e-46
Cf-9 [L. pimpinellifolium]	89	368	3e-26
FLS2 [A.thaliana]	89	357	5e-33
CLV2 [A. thaliana]	93	344	1e-31
CLV2 [A. thaliana]	93	315	2e-12
Cf-9 [L. pimpinellifolium]	96	343	1e-12
CLV2 [A. thaliana]	96	368	5e-19
Cf-9 [L. pimpinellifolium]	97	341	9e-28
FLS2 [A.thaliana]	97	342	9e-29
Xa21 [O. sativa]	97	344	3e-27
Cf-9 [L. pimpinellifolium]	104	344	3e-23
Cf-9 [L. pimpinellifolium]	104	340	2e-22
CLV2 [A. thaliana]	104	296	1e-10
FLS2 [A.thaliana]	104	766	1e-74
FLS2 [A.thaliana]	104	344	7e-35
CLV2 [A. thaliana]	106	344	7e-31
FLS2 [A.thaliana]	106	344	1e-27
Cf-9 [L. pimpinellifolium]	115	368	2e-21
Xa21 [O. sativa]	251	349	5e-13
Xa21 [O. sativa]	253	346	2e-13
Rpg1 [Hordeum vulgare]	495	765	1e-23
Rpg1 [Hordeum vulgare]	497	765	7e-25
Pto [L. esculentum]	498	763	2e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	403	425	out -> in

Report for 6554.m00161

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)