Report for 6559.m00146

 > 6559.m00146, length: 794, copies: 1 

MLRPFPATAHHRCTLLLLLTVTLLPSLAAAAAAHHHHLHDHAAGDGVVISQADYQGLQAIKHDLTDPYAFLRSWN

DTGLGACSGAWVGIKCVQGKVVAITLPWRGLAGTLSERIGQLTQLRRLSLHDNAISGPIPTSLGFLPDLRGVYLF

NNRFSGAVPASIGNCVALQAFDASNNLLTGAIPPSLANSTKLMRLNLSHNTISGDIPSELAASPSLVFLSLSHNK

LSGHIPDTFAGSRAPSSSSLKESITGTYNLAVLELSHNSLDGQIPQSLAGLQKLQVMDLSGNRLNGTIPDRLGSL

ADLKTLDLSGNALTGEIPASLSNLTTTLQAFNVSNNNLSGQVPASLAQKFGPSAFAGNIQLCGYSVSVPCPASPS

PAPSAPASPVQGVETTGRHRKFTTKELALIIAGIVVGILLLLALCCLLLCFLTKKRSGSGGKQTTSSKAAGGGAG

GAAGGGRGEKPGSGAAEVESGGEVGGKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKATLEDGSLVAVKRLR

EKITKGHKDFESEAAVLGKIRHPNLLPLRAYYLGPKGEKLLVLDFMPNGSLSQFLHARAPNTPISWETRMTIAKG

TARGLAFLHDDMTIVHGNLTASNVLLDDHSNPKIADFGLSRLMTTAANSNVLAAAGALGYRAPELSKLKKASAKT

DVYSLGVIILELLTGKSPAETTNGMDLPQWVASIVKEEWTSEVFDLELMRDGDNGPAGDELVDTLKLALHCVDQS

PSVRPDAREVLRQLEQIRPGPEGGAGPSDEGGAGHVAAASAGNE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	142	0.027
LRR [Pfam ls]	167	190	5.4
LRR [Pfam ls]	191	214	0.29
LRR [Pfam ls]	215	238	0.019
LRR [Pfam ls]	254	277	0.051
LRR [Pfam ls]	278	301	0.07
LRR [Pfam fs]	302	325	4.8e-05
LRR [Pfam ls]	302	325	0.00081
LRR [Pfam ls]	327	351	6.3
Ser/Thr pkinase [Pfam ls]	494	767	6.8e-41
Ser/Thr pkinase [Pfam fs]	504	693	5.3e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	119	142	0.0012
LRR [sensitive, ls]	119	142	0.027
LRR [sensitive, ls]	143	166	1.1
LRR [sensitive, ls]	143	166	25
LRR [sensitive, ls]	167	190	0.24
LRR [sensitive, ls]	167	190	5.4
LRR [sensitive, ls]	191	214	0.013
LRR [sensitive, ls]	191	214	0.29
LRR [sensitive, ls]	215	238	0.00085
LRR [sensitive, ls]	215	238	0.019
LRR [sensitive, ls]	254	277	0.0022
LRR [sensitive, ls]	254	277	0.051
LRR [sensitive, ls]	278	301	0.0031
LRR [sensitive, ls]	278	301	0.07
LRR [sensitive, ls]	302	325	3.6e-05
LRR [sensitive, ls]	302	325	0.00081
LRR [sensitive, ls]	327	351	0.28
LRR [sensitive, ls]	327	351	6.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	14	346	1e-36
CLV2 [A. thaliana]	47	298	7e-11
FLS2 [A.thaliana]	51	346	7e-37
CLV2 [A. thaliana]	77	350	1e-26
Xa21 [O. sativa]	79	581	1e-45
Cf-9 [L. pimpinellifolium]	91	370	8e-27
FLS2 [A.thaliana]	91	359	1e-33
CLV2 [A. thaliana]	93	348	3e-29
CLV2 [A. thaliana]	95	343	1e-31
CLV2 [A. thaliana]	95	317	9e-13
Cf-9 [L. pimpinellifolium]	98	345	3e-12
CLV2 [A. thaliana]	98	362	8e-20
Cf-9 [L. pimpinellifolium]	99	343	4e-28
Xa21 [O. sativa]	99	346	5e-29
Cf-9 [L. pimpinellifolium]	106	342	5e-23
FLS2 [A.thaliana]	106	768	1e-74
FLS2 [A.thaliana]	106	346	1e-34
CLV2 [A. thaliana]	108	346	1e-30
FLS2 [A.thaliana]	108	346	1e-27
Cf-9 [L. pimpinellifolium]	117	346	9e-21
Xa21 [O. sativa]	253	351	2e-12
Xa21 [O. sativa]	255	348	9e-14
Rpg1 [Hordeum vulgare]	497	767	1e-23
Rpg1 [Hordeum vulgare]	499	767	7e-25
Pto [L. esculentum]	500	765	2e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out
putative TM domain	405	427	out -> in

Report for 6559.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)