Report for 6592.m00229

 > 6592.m00229, length: 1111, copies: 1 

MSSLGFSSPGFLRLLYILKFFCFLPLVISNETENDRQALLCFKSQITGSAEVLASWSNASMEFCSWHGITCSIQS

PRRVIVLDLSSEGITGCISPCIANLTDLTRLQLSNNSFRGSIPSEIGFLSKLSILDISMNSLEGNIPSELTSCSK

LQEIDLSNNKLQGRIPSAFGDLTELQTLELASNKLSGYIPPSLGSNLSLTYVDLGRNALTGEIPESLASSKSLQV

LVLMNNALSGQLPVALFNCSSLIDLDLKHNSFLGSIPPITAISLQMKYLDLEDNHFTGTIPSSLGNLSSLIYLSL

IANNLVGTIPDIFDHVPTLQTLAVNLNNLSGPVPPSIFNISSLAYLGMANNSLTGRLPSKIGHMLPNIQELILLN

NKFSGSIPVSLLNASHLQKLSLANNSLCGPIPLFGSLQNLTKLDMAYNMLEANDWSFVSSLSNCSRLTELMLDGN

NLQGNLPSSIGNLSSSLEYLWLRNNQISWLIPPGIGNLKSLNMLYMDYNYLTGNIPPTIGYLHNLVFLSFAQNRL

SGQIPGTIGNLVQLNELNLDGNNLSGSIPESIHHCAQLKTLNLAHNSLHGTIPVHIFKIFSLSEHLDLSHNYLSG

GIPQEVGNLINLNKLSISNNRLSGNIPSALGQCVILESLELQSNFLEGIIPESFAKLQSINKLDISHNKLSGKIP

EFLASFKSLINLNLSFNNFYGPLPSFGVFLDTSVISIEGNDRLCARAPLKGIPFCSALVDRGRVHRLLVLAFKIV

TPVVVVVITILCFLMIRSRKRVPQNSRKSMQQEPHLRLFNGDMEKITYQDIVKATNGFSSANLIGSGSFGTVYKG

NLEFRQDQVAIKIFNLSTYGAHRSFAAECEALKNVRHRNLVKVITVCSSVDSTGAEFRALVFEYIQNGNLQMWLH

PKEHEHSQRNFLTLCQRINIALDIAFALDYLHNRCATPLVHCDLKPSNILLGPDMVAYVSDFGLARFICTRSNSD

QDSLTSLYCLKGSIGYIPPEYGMSEERSTKGDVYSFGVLLLEMVTNISPTEEIFNDGTSLRDLVASNFPKDTFKV

VDPTMLQDEIDATEVLQSCVILLVRIGLSCSMTSPKHRCEMGQVCTEILGIKHALSKIDGE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	0.16
LRR [Pfam fs]	150	173	9.6e-06
LRR [Pfam ls]	150	173	0.00015
LRR [Pfam ls]	174	197	1.7
LRR [Pfam ls]	198	221	0.43
LRR [Pfam ls]	222	245	6.8
LRR [Pfam ls]	270	293	0.018
LRR [Pfam ls]	391	413	0.22
LRR [Pfam ls]	441	464	0.045
LRR [Pfam ls]	466	489	0.058
LRR [Pfam ls]	490	513	5.5
LRR [Pfam ls]	514	537	5.4
LRR [Pfam ls]	538	561	0.046
LRR [Pfam ls]	562	586	0.057
LRR [Pfam ls]	611	634	0.2
LRR [Pfam ls]	635	658	0.13
LRR [Pfam ls]	659	682	0.088
Ser/Thr pkinase [Pfam fs]	808	1027	2.1e-43
Ser/Thr pkinase [Pfam ls]	808	1071	3.5e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	102	125	0.0067
LRR [sensitive, ls]	102	125	0.16
LRR [sensitive, ls]	126	149	0.61
LRR [sensitive, ls]	126	149	14
LRR [sensitive, ls]	150	173	6.3e-06
LRR [sensitive, ls]	150	173	0.00015
LRR [sensitive, ls]	174	197	0.074
LRR [sensitive, ls]	174	197	1.7
LRR [sensitive, ls]	198	221	0.018
LRR [sensitive, ls]	198	221	0.43
LRR [sensitive, ls]	222	245	0.29
LRR [sensitive, ls]	222	245	6.8
LRR [sensitive, ls]	246	268	0.49
LRR [sensitive, ls]	246	268	11
LRR [sensitive, ls]	270	293	0.00076
LRR [sensitive, ls]	270	293	0.018
LRR [sensitive, ls]	294	317	0.48
LRR [sensitive, ls]	294	317	11
LRR [sensitive, ls]	318	341	4.3
LRR [sensitive, ls]	318	341	100
LRR [sensitive, ls]	342	365	0.38
LRR [sensitive, ls]	342	365	8.8
LRR [sensitive, ls]	367	390	0.88
LRR [sensitive, ls]	367	390	21
LRR [sensitive, ls]	391	413	0.0092
LRR [sensitive, ls]	391	413	0.22
LRR [sensitive, ls]	414	437	0.38
LRR [sensitive, ls]	414	437	8.9
LRR [sensitive, ls]	441	464	0.0019
LRR [sensitive, ls]	441	464	0.045
LRR [sensitive, ls]	466	489	0.0025
LRR [sensitive, ls]	466	489	0.058
LRR [sensitive, ls]	490	513	0.24
LRR [sensitive, ls]	490	513	5.5
LRR [sensitive, ls]	514	537	0.23
LRR [sensitive, ls]	514	537	5.4
LRR [sensitive, ls]	538	561	0.002
LRR [sensitive, ls]	538	561	0.046
LRR [sensitive, ls]	562	586	0.0025
LRR [sensitive, ls]	562	586	0.057
LRR [sensitive, ls]	587	610	0.38
LRR [sensitive, ls]	587	610	8.8
LRR [sensitive, ls]	611	634	0.0085
LRR [sensitive, ls]	611	634	0.2
LRR [sensitive, ls]	635	658	0.0056
LRR [sensitive, ls]	635	658	0.13
LRR [sensitive, ls]	659	682	0.0038
LRR [sensitive, ls]	659	682	0.088
LRR [sensitive, ls]	683	705	0.55
LRR [sensitive, ls]	683	705	13

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	11	723	2e-70
FLS2 [A.thaliana]	14	1102	1e-160
Xa21 [O. sativa]	53	258	6e-18
Cf-9 [L. pimpinellifolium]	55	718	2e-70
Xa21 [O. sativa]	178	919	1e-155
Cf-9 [L. pimpinellifolium]	336	723	2e-33
CLV2 [A. thaliana]	368	724	3e-33
Rpg1 [Hordeum vulgare]	791	1101	1e-24
Pto [L. esculentum]	799	1094	2e-23
Rpg1 [Hordeum vulgare]	805	1019	6e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	742	764	out -> in
putative TM domain	742	764	out -> in

Report for 6592.m00229

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)