Report for 6592.m00230

 > 6592.m00230, length: 605, copies: 1 

MSSLGFSSPGFLQLLYILKFFCLLPLVIGSNETESDRQALLCLKSQLTGSAEVLSSWSNASMEFCSWHGVTCSTQ

YPRRVTALDLSSEGITGSISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCF

KLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAGRIPQSLASSTSLQ

FLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISPKMYYLDLRFNHLTGTIPSSLGNLSSLTYLC

LIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILP

NNKFSGSIPSSLLNASHLQRLFLTNNSFTGHIPFFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLLDG

NNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNY

LTGNIPPTIGYLHSMVFLSFSHNRLSGQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSLHG

TTIAS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.8
LRR [Pfam fs]	151	174	9.8e-06
LRR [Pfam ls]	151	174	0.00015
LRR [Pfam ls]	175	198	5.6
LRR [Pfam ls]	199	222	6.7
LRR [Pfam ls]	223	246	6
LRR [Pfam ls]	271	294	0.068
LRR [Pfam ls]	295	318	4.6
LRR [Pfam ls]	343	367	1.3
LRR [Pfam ls]	368	391	5.5
LRR [Pfam ls]	392	414	0.033
LRR [Pfam ls]	442	465	0.48
LRR [Pfam ls]	467	490	0.024
LRR [Pfam ls]	491	514	1.3
LRR [Pfam ls]	539	562	3.6
LRR [Pfam ls]	563	586	0.15

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	3.4
LRR [sensitive, ls]	79	102	78
LRR [sensitive, ls]	103	126	0.034
LRR [sensitive, ls]	103	126	0.8
LRR [sensitive, ls]	127	147	1.6
LRR [sensitive, ls]	127	147	38
LRR [sensitive, ls]	151	174	6.5e-06
LRR [sensitive, ls]	151	174	0.00015
LRR [sensitive, ls]	175	198	0.24
LRR [sensitive, ls]	175	198	5.6
LRR [sensitive, ls]	199	222	0.29
LRR [sensitive, ls]	199	222	6.7
LRR [sensitive, ls]	223	246	0.26
LRR [sensitive, ls]	223	246	6
LRR [sensitive, ls]	247	269	0.33
LRR [sensitive, ls]	247	269	7.6
LRR [sensitive, ls]	271	294	0.0029
LRR [sensitive, ls]	271	294	0.068
LRR [sensitive, ls]	295	318	0.2
LRR [sensitive, ls]	295	318	4.6
LRR [sensitive, ls]	319	342	2.5
LRR [sensitive, ls]	319	342	59
LRR [sensitive, ls]	343	367	0.055
LRR [sensitive, ls]	343	367	1.3
LRR [sensitive, ls]	368	391	0.23
LRR [sensitive, ls]	368	391	5.5
LRR [sensitive, ls]	392	414	0.0014
LRR [sensitive, ls]	392	414	0.033
LRR [sensitive, ls]	415	441	0.55
LRR [sensitive, ls]	415	441	13
LRR [sensitive, ls]	442	465	0.02
LRR [sensitive, ls]	442	465	0.48
LRR [sensitive, ls]	467	490	0.001
LRR [sensitive, ls]	467	490	0.024
LRR [sensitive, ls]	491	514	0.054
LRR [sensitive, ls]	491	514	1.3
LRR [sensitive, ls]	515	538	0.32
LRR [sensitive, ls]	515	538	7.5
LRR [sensitive, ls]	539	562	0.15
LRR [sensitive, ls]	539	562	3.6
LRR [sensitive, ls]	563	586	0.0065
LRR [sensitive, ls]	563	586	0.15

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	11	600	4e-55
FLS2 [A.thaliana]	14	601	2e-88
Xa21 [O. sativa]	14	581	2e-82
FLS2 [A.thaliana]	38	600	2e-74
Cf-9 [L. pimpinellifolium]	44	240	4e-16
Cf-9 [L. pimpinellifolium]	56	582	1e-52
Cf-9 [L. pimpinellifolium]	71	600	4e-50
CLV2 [A. thaliana]	76	407	6e-35
FLS2 [A.thaliana]	78	601	9e-72
FLS2 [A.thaliana]	78	361	5e-40
FLS2 [A.thaliana]	79	581	7e-69
Xa21 [O. sativa]	79	248	3e-17
CLV2 [A. thaliana]	80	455	4e-38
FLS2 [A.thaliana]	80	424	1e-45
Cf-9 [L. pimpinellifolium]	83	335	5e-26
Cf-9 [L. pimpinellifolium]	83	216	8e-14
CLV2 [A. thaliana]	83	315	5e-21
FLS2 [A.thaliana]	90	493	7e-51
CLV2 [A. thaliana]	120	601	1e-43
Xa21 [O. sativa]	179	601	3e-75
Cf-9 [L. pimpinellifolium]	203	601	2e-31
Xa21 [O. sativa]	275	605	4e-37

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6592.m00230

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)