Report for 6622.m00173

 > 6622.m00173, length: 997, copies: 1 

MANKRYASFFLFFMMPFSLLHKSYPQLVNQSSDEHQILLEIKRHWGSSPVLGRWSSNSAAHCNWGGITCTDGVVT

GISLPNQTFIKPIPPSICLLKNLTHLDVSYNNISSPFPTMLYNCSNLKYLDLSNNAFAGKLPNDINSLPALLEHL

NLSSNHFTGRIPPSIGLFPRLKSLLLDTNQFDGRYPAEDISNLADLERLTLAVNPFVPAPFPMEFGRLTRLTYLW

LSNMNITGEIPESLSSLRELNVLDLSSNKIQGKIPRWIWQHKKLQILYLYANRFTGEIESNITALNLVEIDVSAN

ELTGTIPDGFGKMTNLTLLFLYFNKLSGSIPPSVGLLPKLTDIRLFNNMLSGSLPSELGKHSPLANLEVSNNNLS

GELPEGLCFNRKLYSIVVFNNSFSGKLPSSLDGCYPLQNLMLYNNNFSGEFPRSLWSVVTDQLSVVMIQNNNFSG

TFPKQLPWNFTRLDISNNRFSGPIPTLAGKMKVFRAANNLLSGEIPWDLTGISQVRLVDLSGNQISGSLPTTIGV

LMRLNTLYLSGNQISGNIPAGFGFITGLNDLDLSSNKLSGEIPKDSNKLLLSFLNLSMNQLTGEIPTSLQNKAYE

QSFLFNLGLCVSSSNSLQNFPICRARANINKDLFGKHIALISAVASIILLVSAVAGFMLLRRKKHLQDHLSWKLT

PFHVLHFTANDILSGLCEQNWIGSGRSGKVYRVYAGDRTSGGRMMAVKKIWNMQNIDNKLEKDFLAEVQILGEIR

HTNIVKLLCCISSSEAKLLIYEYMENGSLHQWLHQRERIGVPGPLDWPTRLQIAIDSARGLCYMHHHCSPPIVHR

DVKCANILLDHNFRAKMADFGLAKILLKAGDDESFSAIAGTFGYMAPEYGHRLKVNEKIDVYSFGVVLLEIITGR

VANDGGEYYCLAQWAWRQYQEYGLSVDLLDEGIRDPTHVEDALEVFTLAVICTGEHPSMRPSMKDVLNILIQFDR

KSTRIQGSLKHAVSDETTLLES

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	97	120	0.11
LRR [Pfam ls]	121	144	0.0058
LRR [Pfam ls]	146	169	0.069
LRR [Pfam ls]	220	243	0.051
LRR [Pfam ls]	244	267	1
LRR [Pfam ls]	268	288	8
LRR [Pfam ls]	291	314	0.026
LRR [Pfam ls]	315	338	0.032
LRR [Pfam ls]	339	362	3.7
LRR [Pfam ls]	411	435	7.1
LRR [Pfam ls]	459	482	0.66
LRR [Pfam ls]	504	527	2.2
LRR [Pfam ls]	528	551	0.12
LRR [Pfam ls]	552	573	4.7
Ser/Thr pkinase [Pfam fs]	691	908	9.3e-46
Ser/Thr pkinase [Pfam ls]	691	971	2.6e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	0.0051
LRR [sensitive, ls]	97	120	0.11
LRR [sensitive, ls]	121	144	0.00028
LRR [sensitive, ls]	121	144	0.0058
LRR [sensitive, ls]	146	169	0.0033
LRR [sensitive, ls]	146	169	0.069
LRR [sensitive, ls]	170	194	2.2
LRR [sensitive, ls]	170	194	46
LRR [sensitive, ls]	220	243	0.0024
LRR [sensitive, ls]	220	243	0.051
LRR [sensitive, ls]	244	267	0.05
LRR [sensitive, ls]	244	267	1
LRR [sensitive, ls]	268	288	0.38
LRR [sensitive, ls]	268	288	8
LRR [sensitive, ls]	291	314	0.0013
LRR [sensitive, ls]	291	314	0.026
LRR [sensitive, ls]	315	338	0.0015
LRR [sensitive, ls]	315	338	0.032
LRR [sensitive, ls]	339	362	0.18
LRR [sensitive, ls]	339	362	3.7
LRR [sensitive, ls]	363	387	0.54
LRR [sensitive, ls]	363	387	11
LRR [sensitive, ls]	411	435	0.34
LRR [sensitive, ls]	411	435	7.1
LRR [sensitive, ls]	437	457	1.3
LRR [sensitive, ls]	437	457	27
LRR [sensitive, ls]	459	482	0.032
LRR [sensitive, ls]	459	482	0.66
LRR [sensitive, ls]	504	527	0.11
LRR [sensitive, ls]	504	527	2.2
LRR [sensitive, ls]	528	551	0.0058
LRR [sensitive, ls]	528	551	0.12
LRR [sensitive, ls]	552	573	0.22
LRR [sensitive, ls]	552	573	4.7
LRR [sensitive, ls]	575	598	2.9
LRR [sensitive, ls]	575	598	60

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	9	616	8e-54
FLS2 [A.thaliana]	12	594	6e-70
Xa21 [O. sativa]	51	784	9e-70
Cf-9 [L. pimpinellifolium]	56	569	2e-50
FLS2 [A.thaliana]	73	333	5e-24
Cf-9 [L. pimpinellifolium]	74	385	9e-23
FLS2 [A.thaliana]	74	977	1e-107
Cf-9 [L. pimpinellifolium]	88	624	2e-52
Cf-9 [L. pimpinellifolium]	173	633	5e-29
FLS2 [A.thaliana]	291	596	1e-32
FLS2 [A.thaliana]	491	604	7e-11
Rpg1 [Hordeum vulgare]	685	974	2e-15
Rpg1 [Hordeum vulgare]	693	991	1e-22
Pto [L. esculentum]	696	967	2e-33

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	638	660	out -> in

Report for 6622.m00173

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)