Report for 6650.m00168

 > 6650.m00168, length: 976, copies: 1 

MLMRHPTIAAAAASSFLLLMIAADGQAATPPPPAAIGNYCEPRERDALLAFKEGVTDDPAGLHASWRRGGGQLQE

DCCQWRGVRCSNLTGHVVKLRLRNDHAGTALAGEIGQSLISLEHLRYLDLSMNNLAGSTGHVPEFLGSFKSLRYL

NLSGIVFSGMVPPQLGNLSNLRYLDLSGIRLSGMVSFLYINDGSWLGHLSNLQYLNLDGVNLSTVVDWSHVLNMI

PSLKIVSLSSCSLQSANQSLPELSFKELEKLDLSNNDFNHPAESSWIWNLTSLKYLNLSSTSLYGDIPRALGNML

SLQVLDFSFDDHKDSMRMSVSKNGNMGTMKANLKNLCNLEVLDLDCRLEYGNITDIFQSLPQCSPSKLKEVHLAG

NTLTGMLPNWIGRLTSLVTLDLFNNSITGQVPSEIGMQTNLRNLYLHFNNMNGTITEKHFAHLTSLKSIYLCYNH

LNIVMDPQWLPPFKLEKSYFASITMGPSFSRWLQSQVDIVALAMNDAGINDTFPDWFSTTFSKAKLLEFPGNQIS

GGLPTNMENMSLEKLYLKSNQIAGLIPRMPRNLTILDLSNNSLSGPLPLNIGSPKLAELNLLSNRITGNVPQSIC

ELQNLHGLDLSNNLLHGEFPQCSGMSMMSFFRLSNNSFSGNFPSFLQGWTELSFLDLSWNKFSGNLPTWIGNFSK

LEILRLKHNMFSGNIPASITKLGNLSHLDLASNSISGPLPQYLANLTGMVPKQYYTNEHEERLSGCDYKSLVTMK

GLELEYDEENVTVVTIDLSSNLLTGVIPEDITYLHRLINLNLSSNYLSGKIPYSIRDMQSLESLDLSKNMLYGEI

PQSLSDLSSLSFLNLSYNNLMGRIPLGTQLGTLYDQNHHLYDGNDGLCGPPLPKSCYKSDASEQGHLMRSKQGFD

IGPFSIGVAMGFMAGLWIVFYALLFMKTWRVAYFCLLDKVYDELQYLKKNENRACRAGTEVLRCKLHQLFWAYIL

P

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	119	145	2.5
LRR [Pfam ls]	146	169	3.6
LRR [Pfam ls]	252	276	4
LRR [Pfam ls]	277	300	1.4
LRR [Pfam ls]	367	390	0.35
LRR [Pfam ls]	391	414	4.3
LRR [Pfam ls]	415	439	0.092
LRR [Pfam ls]	557	579	4.4
LRR [Pfam ls]	604	626	0.19
LRR [Pfam ls]	651	674	3.9
LRR [Pfam ls]	675	698	3.4
LRR [Pfam ls]	699	722	0.063
LRR [Pfam ls]	762	785	0.86
LRR [Pfam ls]	786	809	1.7
LRR [Pfam ls]	810	833	0.06

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	119	145	0.23
LRR [sensitive, ls]	119	145	2.5
LRR [sensitive, ls]	146	169	0.33
LRR [sensitive, ls]	146	169	3.6
LRR [sensitive, ls]	170	191	0.89
LRR [sensitive, ls]	170	191	9.8
LRR [sensitive, ls]	201	223	0.86
LRR [sensitive, ls]	201	223	9.4
LRR [sensitive, ls]	227	249	1.3
LRR [sensitive, ls]	227	249	14
LRR [sensitive, ls]	252	276	0.37
LRR [sensitive, ls]	252	276	4
LRR [sensitive, ls]	277	300	0.13
LRR [sensitive, ls]	277	300	1.4
LRR [sensitive, ls]	367	390	0.032
LRR [sensitive, ls]	367	390	0.35
LRR [sensitive, ls]	391	414	0.39
LRR [sensitive, ls]	391	414	4.3
LRR [sensitive, ls]	415	439	0.0084
LRR [sensitive, ls]	415	439	0.092
LRR [sensitive, ls]	440	464	1.5
LRR [sensitive, ls]	440	464	16
LRR [sensitive, ls]	513	533	6.6
LRR [sensitive, ls]	513	533	72
LRR [sensitive, ls]	536	555	0.51
LRR [sensitive, ls]	536	555	5.6
LRR [sensitive, ls]	557	579	0.4
LRR [sensitive, ls]	557	579	4.4
LRR [sensitive, ls]	580	603	1.3
LRR [sensitive, ls]	580	603	14
LRR [sensitive, ls]	604	626	0.017
LRR [sensitive, ls]	604	626	0.19
LRR [sensitive, ls]	627	650	4.3
LRR [sensitive, ls]	627	650	47
LRR [sensitive, ls]	651	674	0.36
LRR [sensitive, ls]	651	674	3.9
LRR [sensitive, ls]	675	698	0.31
LRR [sensitive, ls]	675	698	3.4
LRR [sensitive, ls]	699	722	0.0058
LRR [sensitive, ls]	699	722	0.063
LRR [sensitive, ls]	762	785	0.079
LRR [sensitive, ls]	762	785	0.86
LRR [sensitive, ls]	786	809	0.15
LRR [sensitive, ls]	786	809	1.7
LRR [sensitive, ls]	810	833	0.0054
LRR [sensitive, ls]	810	833	0.06
LRR [sensitive, ls]	834	856	0.58
LRR [sensitive, ls]	834	856	6.3

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	41	690	4e-44
FLS2 [A.thaliana]	44	881	1e-77
Xa21 [O. sativa]	47	691	4e-42
Cf-9 [L. pimpinellifolium]	77	953	2e-69
CLV2 [A. thaliana]	123	433	3e-18
FLS2 [A.thaliana]	272	869	5e-54
Xa21 [O. sativa]	274	874	9e-49
CLV2 [A. thaliana]	281	856	9e-48
CLV2 [A. thaliana]	350	850	6e-43
Xa21 [O. sativa]	365	851	4e-42
Xa21 [O. sativa]	763	858	4e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	903	925	out -> in

Report for 6650.m00168

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)