Report for 6660.m00248

 > 6660.m00248, length: 576, copies: 1 

MLQELYLPNNGMTRTLPDYDKLMHLTGLRVLDLSYNNLTGPIPRSMGNLSGLDILDLSFNNLTGLIPAGEGCFAG

LSTLVLSENFLTGQIPEEIGYLGSLTTLDLYGNHLSGHVPSEIGKLANLTYLDISRNDLDGVITEEHFARLARLT

TIDLSLNPLKIEVGSEWKPPFSLEKVNFSHCAMGPLFPAWLQWQVDFSCLDISSTGTIPESICESQDLFILDLAN

NLLVGELPRCDSMGTMRYLLLSNNSLSGEFPQFVQSCTSLGFLDLGWNSFSGTLPMWIGDLVQLQFLQLSYNMFS

GNIPNILTKLKLLHHLNLAGNNISGTIPRGLSNLTAMTQTKGIVHSFPYQGYASVVGEPGNSLSVVTKGQELNYG

VGILDMVSIDLSLNDLTGIIPEEMISLDALLNLNLSWNRLSGKIPEKIGIIRSLESLDLSRNMLSGEIPSSLSNL

TYLSFLDLADNNLTGRIPSGSQLDTLYEEHPYMYGGNSGLCGPPLRENCSANDASKLDGQEIAERDFDPMSFGFG

HCLGFVFGLWVVFCVLLFKKSWRLCYFCFIDRIYDQIYVFLVLTCKRFGRG

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	27	50	0.0019
LRR [Pfam ls]	51	73	0.7
LRR [Pfam ls]	75	98	4.4
LRR [Pfam ls]	99	122	0.0067
LRR [Pfam ls]	123	147	0.32
LRR [Pfam ls]	240	263	2.4
LRR [Pfam ls]	288	311	0.13
LRR [Pfam ls]	312	335	0.0086
LRR [Pfam fs]	428	451	2.9e-05
LRR [Pfam ls]	428	451	0.00049
LRR [Pfam ls]	452	474	4.1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	1	23	2.6
LRR [sensitive, ls]	1	23	28
LRR [sensitive, ls]	27	50	0.00017
LRR [sensitive, ls]	27	50	0.0019
LRR [sensitive, ls]	51	73	0.064
LRR [sensitive, ls]	51	73	0.7
LRR [sensitive, ls]	75	98	0.4
LRR [sensitive, ls]	75	98	4.4
LRR [sensitive, ls]	99	122	0.00061
LRR [sensitive, ls]	99	122	0.0067
LRR [sensitive, ls]	123	147	0.029
LRR [sensitive, ls]	123	147	0.32
LRR [sensitive, ls]	148	182	5.1
LRR [sensitive, ls]	148	182	56
LRR [sensitive, ls]	217	239	1.3
LRR [sensitive, ls]	217	239	14
LRR [sensitive, ls]	240	263	0.22
LRR [sensitive, ls]	240	263	2.4
LRR [sensitive, ls]	264	287	2
LRR [sensitive, ls]	264	287	22
LRR [sensitive, ls]	288	311	0.012
LRR [sensitive, ls]	288	311	0.13
LRR [sensitive, ls]	312	335	0.00078
LRR [sensitive, ls]	312	335	0.0086
LRR [sensitive, ls]	380	403	4.2
LRR [sensitive, ls]	380	403	46
LRR [sensitive, ls]	404	427	1.6
LRR [sensitive, ls]	404	427	17
LRR [sensitive, ls]	428	451	4.4e-05
LRR [sensitive, ls]	428	451	0.00049
LRR [sensitive, ls]	452	474	0.38
LRR [sensitive, ls]	452	474	4.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	2	538	3e-57
Cf-9 [L. pimpinellifolium]	2	468	1e-32
CLV2 [A. thaliana]	2	539	9e-45
Xa21 [O. sativa]	2	468	1e-50
Xa21 [O. sativa]	2	492	8e-50
FLS2 [A.thaliana]	5	476	5e-45
FLS2 [A.thaliana]	10	492	6e-55
FLS2 [A.thaliana]	20	470	6e-39
Cf-9 [L. pimpinellifolium]	22	469	6e-36
FLS2 [A.thaliana]	22	468	1e-47
FLS2 [A.thaliana]	25	492	6e-52
Cf-9 [L. pimpinellifolium]	31	469	1e-22
Xa21 [O. sativa]	31	468	1e-40
CLV2 [A. thaliana]	58	469	3e-43
Cf-9 [L. pimpinellifolium]	187	467	1e-11
FLS2 [A.thaliana]	235	469	1e-26
Xa21 [O. sativa]	268	482	1e-17
Xa21 [O. sativa]	381	469	4e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	521	543	out -> in

Report for 6660.m00248

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)