Report for 6660.m00254

 > 6660.m00254, length: 921, copies: 1 

MAVATADGGQVTNGCKPRERDALLAFKEGITDDPAGLLASWRRRRLGGGHELQDCCRWRGVQCSDQTAGHVIKLD

LRNAFQDDHHHDATLVGEIGQSLISLEHLEYLDLSMNNLEGPTGRLPEFLGSFKSLRYLNLSGIRFSGMVPPHIG

NLSNLQILDLSISTVHQDDIYYLPFLYSGDASWLARLSSLQYLNLNGVNLSAALDWPNALNMVPSLKVLSLSSCS

LQSARQSLPLLNVTQLEALDLSENEFNHPTESSWIWNLTSLKYLNLSSTGLYGEIPNALGKMHSLQVLDFSFDEG

YSMGMSITKKGNMCTMKADLKNLCNLQVLFLDYRLASGDIAEIFDSLPQCSPNQQLKEVHLAGNHITGMIPNGIG

RLTSLVTLDLFNNNITGKVPSEIGMLTNLKNLYLHNNHLDGVITEKHFARLINLKSIYLCYNSLKIVVDPEWLPP

FRVEKAYFSSCWMGPKFPAWLQSQVYIVELIMNDAGIDDTFPDWFSTTFSKATFLEISNNQIGGELPTDMENMSV

KRLNLDSNQIAGQIPRMPRNLTLLDISNNHITGHVPQSFCELRNIEGIDLSDNLLKGDFPQCSGMRKMSILRISN

NSFSGNFPSFLQGWTNLSFLDLSWNKFSGSLPTWIGNFSNLEFLRLKHNMFSGNIPVSITKLGRLSHLDLACNCL

SGTIPQYLSNLTSMMRKHYTRKNEERLSGCDYKSSVSMKGQELLYNEKIVPVVTIDLSSNLLIGAIPEDLVSLVG

LINLNLSRNYLSGKIPYRIGDMQSLESLDISKNKLYGEIPVGLSNLTYLSYLNLSYNNLTGRVPSGSQLDTLNDQ

HPYDGNDGLCGPPLENSCSSSSASKQRHLIRSKQSLGMGPFSLGVVLGFIAGLWVVFCTLLFKKSWRVAYFCLLD

NMYNNVCVIVVVQWGRLPGRT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	129	0.52
LRR [Pfam ls]	130	153	0.96
LRR [Pfam ls]	265	288	0.53
LRR [Pfam ls]	355	378	0.15
LRR [Pfam ls]	379	402	0.069
LRR [Pfam ls]	403	427	2.2
LRR [Pfam ls]	501	524	5.4
LRR [Pfam ls]	545	568	0.0017
LRR [Pfam ls]	569	591	0.76
LRR [Pfam ls]	616	639	0.35
LRR [Pfam ls]	640	663	2.5
LRR [Pfam ls]	664	687	0.038
LRR [Pfam ls]	750	773	4.3
LRR [Pfam ls]	774	797	0.022
LRR [Pfam ls]	798	820	2.4

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	129	0.047
LRR [sensitive, ls]	103	129	0.52
LRR [sensitive, ls]	130	153	0.087
LRR [sensitive, ls]	130	153	0.96
LRR [sensitive, ls]	189	211	3.2
LRR [sensitive, ls]	189	211	35
LRR [sensitive, ls]	215	237	0.53
LRR [sensitive, ls]	215	237	5.8
LRR [sensitive, ls]	240	264	1.1
LRR [sensitive, ls]	240	264	12
LRR [sensitive, ls]	265	288	0.049
LRR [sensitive, ls]	265	288	0.53
LRR [sensitive, ls]	355	378	0.013
LRR [sensitive, ls]	355	378	0.15
LRR [sensitive, ls]	379	402	0.0063
LRR [sensitive, ls]	379	402	0.069
LRR [sensitive, ls]	403	427	0.2
LRR [sensitive, ls]	403	427	2.2
LRR [sensitive, ls]	428	452	0.52
LRR [sensitive, ls]	428	452	5.7
LRR [sensitive, ls]	501	524	0.5
LRR [sensitive, ls]	501	524	5.4
LRR [sensitive, ls]	545	568	0.00015
LRR [sensitive, ls]	545	568	0.0017
LRR [sensitive, ls]	569	591	0.069
LRR [sensitive, ls]	569	591	0.76
LRR [sensitive, ls]	592	615	0.54
LRR [sensitive, ls]	592	615	6
LRR [sensitive, ls]	616	639	0.032
LRR [sensitive, ls]	616	639	0.35
LRR [sensitive, ls]	640	663	0.23
LRR [sensitive, ls]	640	663	2.5
LRR [sensitive, ls]	664	687	0.0035
LRR [sensitive, ls]	664	687	0.038
LRR [sensitive, ls]	726	749	3.2
LRR [sensitive, ls]	726	749	35
LRR [sensitive, ls]	750	773	0.39
LRR [sensitive, ls]	750	773	4.3
LRR [sensitive, ls]	774	797	0.002
LRR [sensitive, ls]	774	797	0.022
LRR [sensitive, ls]	798	820	0.22
LRR [sensitive, ls]	798	820	2.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	17	655	5e-37
FLS2 [A.thaliana]	19	886	2e-70
Xa21 [O. sativa]	22	740	6e-43
Cf-9 [L. pimpinellifolium]	55	843	2e-68
CLV2 [A. thaliana]	201	884	1e-50
Xa21 [O. sativa]	262	855	9e-49
Xa21 [O. sativa]	541	869	2e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	864	886	out -> in
putative TM domain	893	915	in -> out

Report for 6660.m00254

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)