Report for 6675.m00234

 > 6675.m00234, length: 833, copies: 1 

MAGASHHLVVFLAALLALLPGSSQLQYSQTWTLFKIQQMLNHPPVLSHWRRTTDFCGGGGTAAPSAAVVCYGDTV

TQLHIAGVRGAPPLPMNFSIGALVMALSRLPDLKVLTLSGLGLWGPLPDKIGRLAALEIVNMSGNYLYGGVPGGL

SQLTGLQTLILDDNLLAGELPAWIGELPQLAVLSLRNNSLGGAVPASVGRMESLRSLVLASNNLTGNLPDMSGLT

NLQVIDVGDNWLGPAFPALGRKVVTVVLSRNRFTGGLPGEITSFYLLERLDVSWNRFVGPFMPALLSLPAIRYLN

VAGNRFTGVLSDKVACGDNLQFVDLSSNLLTGSEPACLRPDKKPATVVLVNANCLEATGGDASQHPSPFCQNQAL

AVGITHGGKVRKKLTHHAGFLAGIAMAALAAASAIAVVAVVAVRRKNKKGVMVRPPAMLGEDNSSSTSGYPSKMF

ADARYISQTVKLGALGIPPYRTFSLVELEAATDNFENSLLLGQDSFGEMYRGRLGNGTLVAIRSLKVKRNQSSLS

FSRHIETISRLRHRNLVSALGHCFEYDLDDSTVTQLYLVFEYVQNGNLRSRISQGTEGRKLTWAQRISAAIGIAN

GIQFLHAGMMPGLFGNNLKINNILLDQNHVAKISSYNIPILGEAMKSEGGPGGKHHTESPLLNDKTDIFDFGVIL

LEIVSGKPITSLYEVEIMKELMLWAVADEDLVRRRSFADQEVSKGCSDESLRTIMQICLRCLAKEAVQRPSIEDV

LWNLQFAAQVQDDWEGDNRSSDGSMVSSSSRITKSSRFQNEQTRSGREKECEDSSARGSVWLQAATEDGNFETGR

RQAEDERY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	155	178	3
LRR [Pfam ls]	203	225	0.34
LRR [Pfam ls]	319	339	7.5
Ser/Thr pkinase [Pfam fs]	485	606	1.3e-12
Ser/Thr pkinase [Pfam ls]	485	756	3.1e-12
Ser/Thr pkinase [Pfam fs]	671	756	0.19

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	107	130	3.3
LRR [sensitive, ls]	107	130	100
LRR [sensitive, ls]	131	154	0.28
LRR [sensitive, ls]	131	154	8.9
LRR [sensitive, ls]	155	178	0.094
LRR [sensitive, ls]	155	178	3
LRR [sensitive, ls]	179	202	0.47
LRR [sensitive, ls]	179	202	15
LRR [sensitive, ls]	203	225	0.011
LRR [sensitive, ls]	203	225	0.34
LRR [sensitive, ls]	226	245	0.92
LRR [sensitive, ls]	226	245	29
LRR [sensitive, ls]	247	270	2
LRR [sensitive, ls]	247	270	61
LRR [sensitive, ls]	271	294	1.7
LRR [sensitive, ls]	271	294	53
LRR [sensitive, ls]	295	315	2.4
LRR [sensitive, ls]	295	315	74
LRR [sensitive, ls]	319	339	0.24
LRR [sensitive, ls]	319	339	7.5

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	69	353	4e-13
FLS2 [A.thaliana]	70	333	3e-23
Cf-9 [L. pimpinellifolium]	77	389	9e-13
CLV2 [A. thaliana]	89	338	2e-18
FLS2 [A.thaliana]	89	339	2e-23
Xa21 [O. sativa]	89	338	5e-16
FLS2 [A.thaliana]	92	355	8e-25
Xa21 [O. sativa]	92	235	4e-11
Xa21 [O. sativa]	92	336	7e-25
CLV2 [A. thaliana]	96	317	8e-12
FLS2 [A.thaliana]	96	754	4e-52
FLS2 [A.thaliana]	96	335	1e-27
FLS2 [A.thaliana]	96	353	7e-24
Xa21 [O. sativa]	96	593	2e-33
CLV2 [A. thaliana]	101	335	7e-18
FLS2 [A.thaliana]	101	335	1e-23
Xa21 [O. sativa]	101	358	8e-11
Cf-9 [L. pimpinellifolium]	102	335	2e-16
CLV2 [A. thaliana]	108	328	3e-23
CLV2 [A. thaliana]	108	338	8e-20
CLV2 [A. thaliana]	111	351	2e-17
Xa21 [O. sativa]	111	334	3e-24
FLS2 [A.thaliana]	118	338	3e-18
Cf-9 [L. pimpinellifolium]	132	335	3e-15
Rpg1 [Hordeum vulgare]	469	751	6e-19
Rpg1 [Hordeum vulgare]	471	751	2e-23
Pto [L. esculentum]	473	762	6e-39

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	396	418	out -> in
putative TM domain	592	614	in -> out

Report for 6675.m00234

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)