Report for 6679.m00159

 > 6679.m00159, length: 508, copies: 1 

MAKLAVPPLLVILVLLQSATRLPVAETSTADEEYMHRLPAATGAERLLGWKADSDPCNGSWVGVTCAPFDGNRII

QIDVRGLLRGGGTLPELDRQAGSLSHLRMLDLGDNNLTGPVPTLFLDRLLTLRLDGNAFSGLPHSFFRGMPELHY

FSISDNPRLEEWGLWSDLLSLTELRVFNASNANINGTLQVFLGNLGAFPALAEVSLARNRLTGVVPEKLVSQSIA

KLDLSSNGLSGSINFINNLASSITDLRLDHNHFSGPFPADLSGLYLLSVFSVAHNRLTGVVPPSLARVWRLSWVS

VSDNLLQGPVPELPDSVKTDFAEAAVKGSFCRLDVHGPCDQETSSLLSVAAAFHYPEILDVSWRRDDPCNGWLGI

HCGDGDGGGGGRNKVTGVNLSRLGLNGTIDPAFASLLYLEAIILAGNNLTGTVPASILQMPSLRVLDVSNNALEG

TVLSVRHDVLILADGNRGGLNVTAIAASGSFSSSRFQLSEATTPFLTFATVFVALFGY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	101	120	5.4
LRR [Pfam ls]	123	146	0.022
LRR [Pfam ls]	223	245	6.3

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	101	120	0.17
LRR [sensitive, ls]	101	120	5.4
LRR [sensitive, ls]	123	146	0.0007
LRR [sensitive, ls]	123	146	0.022
LRR [sensitive, ls]	173	196	1.8
LRR [sensitive, ls]	173	196	58
LRR [sensitive, ls]	200	220	1.6
LRR [sensitive, ls]	200	220	51
LRR [sensitive, ls]	223	245	0.2
LRR [sensitive, ls]	223	245	6.3
LRR [sensitive, ls]	247	270	0.41
LRR [sensitive, ls]	247	270	13
LRR [sensitive, ls]	271	291	4.2
LRR [sensitive, ls]	271	291	130
LRR [sensitive, ls]	295	318	0.7
LRR [sensitive, ls]	295	318	22
LRR [sensitive, ls]	389	412	1.6
LRR [sensitive, ls]	389	412	51
LRR [sensitive, ls]	413	436	0.4
LRR [sensitive, ls]	413	436	12
LRR [sensitive, ls]	437	459	0.43
LRR [sensitive, ls]	437	459	13

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	43	452	5e-25
Cf-9 [L. pimpinellifolium]	46	452	1e-15
FLS2 [A.thaliana]	57	452	1e-17
CLV2 [A. thaliana]	60	446	9e-21
Xa21 [O. sativa]	86	311	1e-12
CLV2 [A. thaliana]	87	452	1e-14
FLS2 [A.thaliana]	87	452	2e-21
FLS2 [A.thaliana]	87	312	1e-19
FLS2 [A.thaliana]	91	452	3e-23
CLV2 [A. thaliana]	97	454	4e-16
Xa21 [O. sativa]	97	452	8e-16
Cf-9 [L. pimpinellifolium]	98	479	4e-18
Cf-9 [L. pimpinellifolium]	100	452	1e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6679.m00159

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)