Report for 6742.m00196

 > 6742.m00196, length: 643, copies: 1 

MEVISRHRAPASSSSLCLLFLTFLLSVSMAAATEKSPMQLNKAQENIMRDILGLVSSAMDSSLTKSWNTSSNPCE

WSGVHCTSAASSSFVTRLSLPGYGLSNATILASICLLDTLHSLNLSRNSFTDLPSQFSPCPMKAELQVLDLSYNR

LSSHLGNFSGFHELEVLDLSFNSLNDNISTQLNYLPKLRSLNLSSNGFEGPIPTSMVTSLEELVFSGNNFSGRIP

MGLFRYGNITLLDLSQNNLVDDVPDGFLSFPKLRILLLSENNLTGKIPQSLLNVTTLFRFASNENKLSGSIPQGI

TKNIRMLDLSYNMLNGEMPSDLLSPDSLETIDLTANRLEGLIPGNFSRSLYHLRLGCNLLSGSIPESIGNAIRLA

YLELDDNQLSGPIPSQLGKCNNMVLMDLSTNKLQGVVPDELRNLQQLEVIKLQTNNFSGYIPRIFSGMTNMEVLN

LSANSFSGEIPSTLVLLSKLCYLDLHGNNFSGVIPPSISSLQFLSTLDLGNNQLTGTIPTMPTKIGALILSHNHL

QGSIPSSIGALSNLLLLDLSDNHLSGQVPSSFANLKGLIYLSLCYNQLSGPMPELPRGVKVDVSGNPGLTICTED

SDSQYNMASTEDDFRSTTWVATVSFVVGFIISFYWAGIRKYCY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	114	136	0.0092
LRR [Pfam ls]	140	162	0.015
LRR [Pfam ls]	163	186	3.2
LRR [Pfam ls]	187	207	4.1
LRR [Pfam ls]	233	256	0.057
LRR [Pfam ls]	257	281	0.04
LRR [Pfam ls]	303	324	1.5
LRR [Pfam ls]	327	347	1.5
LRR [Pfam ls]	349	372	4.8
LRR [Pfam ls]	373	396	2
LRR [Pfam ls]	397	420	1.7
LRR [Pfam ls]	421	444	1.6
LRR [Pfam ls]	445	468	1.4
LRR [Pfam ls]	469	492	0.054
LRR [Pfam ls]	514	537	1.2
LRR [Pfam ls]	538	561	0.0044

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	114	136	0.00084
LRR [sensitive, ls]	114	136	0.0092
LRR [sensitive, ls]	140	162	0.0014
LRR [sensitive, ls]	140	162	0.015
LRR [sensitive, ls]	163	186	0.29
LRR [sensitive, ls]	163	186	3.2
LRR [sensitive, ls]	187	207	0.37
LRR [sensitive, ls]	187	207	4.1
LRR [sensitive, ls]	209	229	0.81
LRR [sensitive, ls]	209	229	8.9
LRR [sensitive, ls]	233	256	0.0052
LRR [sensitive, ls]	233	256	0.057
LRR [sensitive, ls]	257	281	0.0036
LRR [sensitive, ls]	257	281	0.04
LRR [sensitive, ls]	303	324	0.14
LRR [sensitive, ls]	303	324	1.5
LRR [sensitive, ls]	327	347	0.14
LRR [sensitive, ls]	327	347	1.5
LRR [sensitive, ls]	349	372	0.44
LRR [sensitive, ls]	349	372	4.8
LRR [sensitive, ls]	373	396	0.18
LRR [sensitive, ls]	373	396	2
LRR [sensitive, ls]	397	420	0.16
LRR [sensitive, ls]	397	420	1.7
LRR [sensitive, ls]	421	444	0.15
LRR [sensitive, ls]	421	444	1.6
LRR [sensitive, ls]	445	468	0.12
LRR [sensitive, ls]	445	468	1.4
LRR [sensitive, ls]	469	492	0.0049
LRR [sensitive, ls]	469	492	0.054
LRR [sensitive, ls]	493	512	0.62
LRR [sensitive, ls]	493	512	6.8
LRR [sensitive, ls]	514	537	0.11
LRR [sensitive, ls]	514	537	1.2
LRR [sensitive, ls]	538	561	0.0004
LRR [sensitive, ls]	538	561	0.0044
LRR [sensitive, ls]	562	585	0.53
LRR [sensitive, ls]	562	585	5.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	18	642	2e-54
Xa21 [O. sativa]	25	462	1e-32
Cf-9 [L. pimpinellifolium]	64	579	6e-52
Xa21 [O. sativa]	66	578	5e-61
FLS2 [A.thaliana]	82	509	3e-47
Cf-9 [L. pimpinellifolium]	87	591	1e-48
FLS2 [A.thaliana]	93	591	7e-67
FLS2 [A.thaliana]	97	507	3e-47
FLS2 [A.thaliana]	103	556	3e-50
FLS2 [A.thaliana]	105	579	5e-59
Cf-9 [L. pimpinellifolium]	106	506	4e-35
FLS2 [A.thaliana]	178	578	5e-67
FLS2 [A.thaliana]	232	583	7e-50
FLS2 [A.thaliana]	301	578	5e-35
FLS2 [A.thaliana]	357	578	2e-24
Xa21 [O. sativa]	417	579	4e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	32	in -> out
putative TM domain	616	638	out -> in

Report for 6742.m00196

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)