Report for 6742.m00198

 > 6742.m00198, length: 694, copies: 1 

MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRM

AMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPW

VSFTSFDLNVANMDNFFAPVFTMGKYYTQGDKVLMPLAIQKFDDKLSNMRIGRRPGRPQGVRVGRFINAAGTTGF

PTGKRAETAMTMITPSYLGDTIEYSSLNLSSNGFEGPVPTSIATSLEDLVLSGNNFSDHIPMGLFRYGNLTLLDL

CRNNLHGDVPDGFLSFPKLRILVLSENNLTGKIPRSLLNVTTLFRFGGNQNNFVGSIPQGITRNIRMLDLSYNML

NGDIPSELLSPDTLETIDLTANRLEGFIPGNVSRSLHSIRLGRNLLGGSIPESIGNAIDLVNLLLDGNKLVGYIP

WQLSRCKNLALIDLSSNQVQGNIPIGLGNLEQLVVLKLQKNNLSGDIPSSFSDMSALEILNLSHNSFTGELPFTN

STQSLKLCYLGLHGNKLNGVIPSSISLLQSLITIDLGNNELIGIIPTNIGTFLKLERLDLSKNYLSGQVPSSVAN

LERLMCLFLSDNNLSGPLPELPKWVMVNVTGNPGIILDTEENRTSGSMKGSQDDFRSAIWVAAASFVLGFSLSFY

WAGPGEKLMPRLETLHCDD

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	294	317	0.14
LRR [Pfam ls]	318	342	0.035
LRR [Pfam ls]	364	385	0.58
LRR [Pfam ls]	458	481	0.38
LRR [Pfam ls]	482	505	0.065
LRR [Pfam ls]	506	527	2.4
LRR [Pfam ls]	531	554	2.2
LRR [Pfam ls]	579	602	0.097

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	270	290	0.59
LRR [sensitive, ls]	270	290	6.5
LRR [sensitive, ls]	294	317	0.013
LRR [sensitive, ls]	294	317	0.14
LRR [sensitive, ls]	318	342	0.0032
LRR [sensitive, ls]	318	342	0.035
LRR [sensitive, ls]	364	385	0.053
LRR [sensitive, ls]	364	385	0.58
LRR [sensitive, ls]	388	408	0.81
LRR [sensitive, ls]	388	408	8.9
LRR [sensitive, ls]	410	433	0.98
LRR [sensitive, ls]	410	433	11
LRR [sensitive, ls]	434	457	1.1
LRR [sensitive, ls]	434	457	12
LRR [sensitive, ls]	458	481	0.034
LRR [sensitive, ls]	458	481	0.38
LRR [sensitive, ls]	482	505	0.0059
LRR [sensitive, ls]	482	505	0.065
LRR [sensitive, ls]	506	527	0.22
LRR [sensitive, ls]	506	527	2.4
LRR [sensitive, ls]	531	554	0.2
LRR [sensitive, ls]	531	554	2.2
LRR [sensitive, ls]	555	578	0.52
LRR [sensitive, ls]	555	578	5.7
LRR [sensitive, ls]	579	602	0.0089
LRR [sensitive, ls]	579	602	0.097
LRR [sensitive, ls]	603	625	2
LRR [sensitive, ls]	603	625	21

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	235	620	4e-51
Cf-9 [L. pimpinellifolium]	240	476	4e-18
FLS2 [A.thaliana]	240	630	3e-44
Xa21 [O. sativa]	240	619	8e-50
Cf-9 [L. pimpinellifolium]	242	620	2e-45
Cf-9 [L. pimpinellifolium]	243	648	2e-37
Cf-9 [L. pimpinellifolium]	250	522	5e-26
CLV2 [A. thaliana]	251	519	1e-27
Cf-9 [L. pimpinellifolium]	252	620	2e-45
CLV2 [A. thaliana]	252	646	6e-38
CLV2 [A. thaliana]	252	670	1e-34
FLS2 [A.thaliana]	252	619	3e-46
Xa21 [O. sativa]	252	648	4e-43
Xa21 [O. sativa]	259	528	1e-31
Cf-9 [L. pimpinellifolium]	269	648	1e-29
CLV2 [A. thaliana]	274	648	4e-40
Cf-9 [L. pimpinellifolium]	284	616	2e-26
CLV2 [A. thaliana]	293	648	2e-33
FLS2 [A.thaliana]	293	620	1e-33
Cf-9 [L. pimpinellifolium]	336	659	6e-24
CLV2 [A. thaliana]	346	619	6e-25
Cf-9 [L. pimpinellifolium]	392	618	6e-11
Xa21 [O. sativa]	435	619	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value
Chloramphenicol acetyltransferase	6	197	1.7e-128

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	658	677	out -> in

Report for 6742.m00198

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)