Report for 761.m00070

 > 761.m00070, length: 686, copies: 1 

MRAAWRPASGRRVALAAMVVLSVVVAAAMADDLAGDARALLAFRDAVGRHVAWNGSDPGGACSWTGVTCEGGRVA

VLRLPGAALAGRVPEGTLGNLTALHTLSLRLNALAGALPGDLTSAAALRNVFLNGNRLSGEFPRAFLALQGLVRL

AIGGNDLSGSIPPALGNLTRLKVLLLENNRFSGEIPDLKQPLQQFNVSFNQLNGSIPATLRTMPRSAFLGTGLCG

GPLGPCPGEVSPSPAPGEQPVSPTPANNGDKGGNGGESGKKSKKLSGGAIAGIAIGSAVGAALLLFLLICLCCRS

GRTKTRSMEMPPPPSSAPAVVAAGRKPPEMTSAAAVAPMATVGNPHAPLGQSTSGKKLIFFGSAAAVAPFDLEDL

LRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLTEPEFRDRIADIGELQHEFIVPLRAYYYSKDEKLLVYD

FMPMGSLSAVLHGNRGSGRTPLNWETRSSIALAAARGVEYIHSTSSSASHGNIKSSNVLLNKSYQARLSDNGLSA

LVGPSSAPSRASGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVVRSEWTAEV

FDMELLRYQNVEEQMVQLLQLAIDCVAQVPDARPSMPHVVLRIEEIKKSSERLEGRDPQQQASNLEAGDDQTSKP

ESAEGLNPFAP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	122	145	7.3
LRR [Pfam ls]	146	169	0.3
Ser/Thr pkinase [Pfam fs]	377	572	6.8e-34
Ser/Thr pkinase [Pfam ls]	377	640	1.1e-32

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	73	97	1.3
LRR [sensitive, ls]	73	97	40
LRR [sensitive, ls]	122	145	0.23
LRR [sensitive, ls]	122	145	7.3
LRR [sensitive, ls]	146	169	0.0096
LRR [sensitive, ls]	146	169	0.3
LRR [sensitive, ls]	170	189	0.77
LRR [sensitive, ls]	170	189	24
LRR [sensitive, ls]	191	214	0.92
LRR [sensitive, ls]	191	214	29

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	22	235	3e-15
Xa21 [O. sativa]	32	207	5e-25
FLS2 [A.thaliana]	62	207	3e-13
FLS2 [A.thaliana]	69	220	2e-12
FLS2 [A.thaliana]	73	210	3e-11
FLS2 [A.thaliana]	73	207	1e-10
FLS2 [A.thaliana]	76	210	5e-12
CLV2 [A. thaliana]	77	210	4e-11
Xa21 [O. sativa]	77	214	2e-14
Xa21 [O. sativa]	83	462	2e-15
FLS2 [A.thaliana]	84	661	4e-35
FLS2 [A.thaliana]	84	245	3e-11
FLS2 [A.thaliana]	93	213	3e-13
Pto [L. esculentum]	370	644	2e-31
Rpg1 [Hordeum vulgare]	378	646	5e-12
Rpg1 [Hordeum vulgare]	382	682	2e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	30	in -> out
putative TM domain	274	296	out -> in

Report for 761.m00070

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)